product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macrothele gigas Mu-hexatoxin-Mg1a
catalog :
MBS1264201
quantity :
1 mg (E-Coli)
price :
1010 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1264201
products type :
Recombinant Protein
products full name :
Recombinant Macrothele gigas Mu-hexatoxin-Mg1a
products short name :
Mu-hexatoxin-Mg1a
products name syn :
Recombinant Mu-hexatoxin-Mg1a; Mu-hexatoxin-Mg1a; Mu-HXTX-Mg1a; Neurotoxin magi-2
other names :
Mu-hexatoxin-Mg1a; Mu-hexatoxin-Mg1a; Neurotoxin magi-2
other gene names :
Mu-HXTX-Mg1a; Mu-HXTX-Mg1a
uniprot entry name :
TXMG2_MACGS
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
81-121
sequence length :
121
sequence :
CMGYDIECNENLPCCKHRKLECVETSGYWWYKRKYCRPI
KG
purity :
>90%(SDS-PAGE)
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree c for up to one week.
other info1 :
Species: Macrothele gigas (Spider)
products description :
Insecticidal neurotoxin. Shows competition for site 3 of insect voltage-gated sodium channels (Nav). Induces flaccid paralysis when injected into lepidopteran larvae. Is not toxic to mice when injected intracranially at 20 pmol/g.
ncbi gi num :
62512115
ncbi acc num :
P83558.2
uniprot acc num :
P83558
ncbi mol weight :
31kD
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
Function: Insecticidal neurotoxin. Shows competition for site 3 of insect voltage-gated sodium channels. Induces flaccid paralysis when injected into lepidopteran larvae. Is not toxic to mice when injected intracranially at 20 pmol/g. Ref.2. Subcellular location: Secreted Ref.2. Tissue specificity: Expressed by the venom gland. Ref.2. Domain: The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin . By similarity. Toxic dose: LD50 is 17.6 nmol/kg to lepidopteran larvae. Ref.2. Sequence similarities: Belongs to the magi-1 family. Mass spectrometry: Molecular mass is 4940.3 Da from positions 81 - 121. Determined by MALDI. Ref.2
size1 :
1 mg (E-Coli)
price1 :
1010 USD
size2 :
1 mg (Yeast)
price2 :
1470
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!