catalog number :
MBS1264011
products type :
Recombinant Protein
products full name :
Recombinant Protein E7 (E7)
products short name :
Protein E7 (E7)
products name syn :
Protein E7
other names :
transforming protein; Protein E7; transforming protein
other gene names :
E7; E7
uniprot entry name :
VE7_HPV16
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1–98, Full length.
sequence :
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEID
GPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRT
LEDLLMGTLGIVCPICSQKP
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human papillomavirus type 16
products description :
E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription.
ncbi acc num :
NP_041326.1
ncbi gb acc num :
NC_001526.2
size4 :
0.05 mg (Baculovirus)