product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Clostridium tetani Tetanus toxin
catalog :
MBS1262435
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1262435
products type :
Recombinant Protein
products full name :
Recombinant Clostridium tetani Tetanus toxin
products short name :
Tetanus toxin
products name syn :
Tentoxylysin
other names :
tetanus toxin; Tetanus toxin; tetanus toxin; Tentoxylysin
products gene name :
tetX
other gene names :
CTC_RS14060; tetX; Tetanus toxin chain L; Tetanus toxin chain H
uniprot entry name :
TETX_CLOTE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
123-573; Partial
sequence length :
573
sequence :
SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFG
PGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCP
EYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVL
HGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQ
DANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNI
DIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMY
GFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYN
DTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSK
LIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNE
DLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKI
IVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIE
IHNIDDNTIYQYLYAQKSPTTL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln- -Phe-77' bond of synaptobrevin-2.
products references :
Tetanus toxin primary structure, expression in E. coli, and homology with botulinum toxins.Eisel U., Jarausch W., Goretzki K., Henschen A., Engels J., Weller U., Hudel M., Habermann E., Niemann H.EMBO J. 5:2495-2502(1986) The complete nucleotide sequence of tetanus toxin.Fairweather N.F., Lyness V.A.Nucleic Acids Res. 14:7809-7812(1986) The genome sequence of Clostridium tetani, the causative agent of tetanus disease.Brueggemann H., Baeumer S., Fricke W.F., Wiezer A., Liesegang H., Decker I., Herzberg C., Martinez-Arias R., Merkl R., Henne A., Gottschalk G.Proc. Natl. Acad. Sci. U.S.A. 100:1316-1321(2003) Cloning, nucleotide sequencing, and expression of tetanus toxin fragment C in Escherichia coli.Fairweather N.F., Lyness V.A., Pickard D.J., Allen G., Thomson R.O.J. Bacteriol. 165:21-27(1986) Arrangement of disulfide bridges and positions of sulfhydryl groups in tetanus toxin.Krieglstein K., Henschen A., Weller U., Habermann E.Eur. J. Biochem. 188:39-45(1990) Limited proteolysis of tetanus toxin. Relation to activity and identification of cleavage sites.Krieglstein K.G., Henschen A.H., Weller U., Habermann E.Eur. J. Biochem. 202:41-51(1991) Tetanus toxin is a zinc protein and its inhibition of neurotransmitter release and protease activity depend on zinc.Schiavo G., Poulain B., Rossetto O., Benfenati F., Tauc L., Montecucco C.EMBO J. 11:3577-3583(1992) Tetanus and botulinum-B neurotoxins block neurotransmitter release by proteolytic cleavage of synaptobrevin.Schiavo G., Benfenati F., Poulain B., Rossetto O., de Laureto P.P., Dasgupta B.R., Montecucco C.Nature 359:832-835(1992) Structure of the receptor binding fragment HC of tetanus neurotoxin.Umland T.C., Wingert L.M., Swaminathan S., Furey W.F. Jr., Schmidt J.J., Sax M.Nat. Struct. Biol. 4:788-792(1997)
ncbi gi num :
499413369
ncbi acc num :
WP_011100836.1
ncbi gb acc num :
WP_011100836.1
uniprot acc num :
P04958
ncbi mol weight :
55.42kD
ncbi pathways :
Disease Pathway (1268854); Infectious Disease Pathway (1269056); Neurotoxicity Of Clostridium Toxins Pathway (1269145); Toxicity Of Tetanus Toxin (TeNT) Pathway (1269149); Uptake And Actions Of Bacterial Toxins Pathway (1269144)
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!