product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Ustilago maydis P6 virus KP6 killer toxin
catalog :
MBS1260801
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1260801
products type :
Recombinant Protein
products full name :
Recombinant Ustilago maydis P6 virus KP6 killer toxin
products short name :
KP6 killer toxin
other names :
KP6 killer toxin; KP6 killer toxin; Killer protein 6
products gene name :
KP6
uniprot entry name :
KP6T_UMV6
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
28-105
sequence length :
219
sequence :
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHL
SKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.
products references :
Ustilago maydis KP6 killer toxin structure, expression in Saccharomyces cerevisiae, and relationship to other cellular toxins.Tao J., Ginsberg I., Banerjee N., Held W., Koltin Y., Bruenn J.A.Mol. Cell. Biol. 10:1373-1381(1990) Mutants of Ustilago maydis defective in production of one of two polypeptides of KP6 toxin from the preprotoxin.Tao J., Ginzberg I., Koltin Y., Bruenn J.A.Mol. Gen. Genet. 238:234-240(1993) Structure of Ustilago maydis killer toxin KP6 alpha-subunit. A multimeric assembly with a central pore.Li N., Erman M., Pangborn W., Duax W.L., Park C.M., Bruenn J., Ghosh D.J. Biol. Chem. 274:20425-20431(1999)
ncbi gi num :
125528
ncbi acc num :
P16948.1
uniprot acc num :
P16948
ncbi mol weight :
24.59kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!