catalog number :
MBS1259589
products type :
Recombinant Protein
products full name :
Recombinant Epstein-Barr virus DNA polymerase catalytic subunit
products short name :
DNA polymerase catalytic subunit
other names :
DNA polymerase; DNA polymerase catalytic subunit; DNA polymerase
products gene name :
BALF5
other gene names :
BALF5; BALF5
uniprot entry name :
DPOL_EBVB9
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-210
sequence :
MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAA
GVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQE
GTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQ
GYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAP
QGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGY
GNHAGDYHKITLSHP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.
products references :
Sequence analysis of the 17,166 base-pair EcoRI fragment C of B95-8 Epstein-Barr virus.Bankier A.T., Deininger P.L., Farrell P.J., Barrell B.G.Mol. Biol. Med. 1:21-45(1983)
DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984)
A major DNA binding protein encoded by BALF2 open reading frame of Epstein-Barr virus (EBV)
forms a complex with other EBV DNA-binding proteins
DNAase, EA-D, and DNA polymerase.Zeng Y., Middeldorp J., Madjar J.J., Ooka T.Virology 239:285-295(1997)
The Epstein-Barr virus pol catalytic subunit physically interacts with the BBLF4-BSLF1-BBLF2/3 complex.Fujii K., Yokoyama N., Kiyono T., Kuzushima K., Homma M., Nishiyama Y., Fujita M., Tsurumi T.J. Virol. 74:2550-2557(2000)
Architecture of replication compartments formed during Epstein-Barr virus lytic replication.Daikoku T., Kudoh A., Fujita M., Sugaya Y., Isomura H., Shirata N., Tsurumi T.J. Virol. 79:3409-3418(2005)
A functional and structural basis for TCR cross-reactivity in multiple sclerosis.Lang H.L.E., Jacobsen H., Ikemizu S., Andersson C., Harlos K., Madsen L., Hjorth P., Sondergaard L., Svejgaard A., Wucherpfennig K., Stuart D.I., Bell J.I., Jones E.Y., Fugger L.Nat. Immunol. 3:940-943(2002)
ncbi acc num :
YP_401712.1
ncbi gb acc num :
NC_007605.1
size4 :
0.05 mg (Baculovirus)