Recombinant Escherichia coli (strain K12) Outer membrane protein C | MyBioSource MBS1259203 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Escherichia coli (strain K12) Outer membrane protein C

catalog :

MBS1259203

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1259203

products type :

Recombinant Protein

products full name :

Recombinant Escherichia coli (strain K12) Outer membrane protein C

products short name :

Outer membrane protein C

products name syn :

Outer membrane protein 1B; Porin OmpC

other names :

outer membrane porin protein C; Outer membrane protein C; outer membrane porin protein C; Outer membrane protein 1B; Porin OmpC

products gene name :

ompC

other gene names :

ompC; ompC; butR; ECK2207; JW2203; meoA; par; meoA; par

uniprot entry name :

OMPC_ECOLI

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

22-367, Mature full length protein

sequence length :

367

sequence :

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFA
GLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGS
DNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNP
SGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGG
AISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYL
AAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRP
SLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMST
YVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Forms pores that allow passive diffusion of small molecules across the outer membrane.

products references :

A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregulated ompC gene.Mizuno T., Chou M.-Y., Inouye M.J. Biol. Chem. 258:6932-6940(1983) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Automated multiplex sequencing of the E Coli genome.Richterich P., Lakey N., Gryan G., Jaehn L., Mintz L., Robison K., Church G.M. DNA sequence of the promoter region of the ompC gene and the amino acid sequence of the signal peptide of pro-OmpC protein of Escherichia coli.Mizuno T., Chou M.-Y., Inouye M.FEBS Lett. 151:159-164(1983) Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products.Nogami T., Mizuno T., Mizushima S.J. Bacteriol. 164:797-801(1985) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis.Molloy M.P., Herbert B.R., Walsh B.J., Tyler M.I., Traini M., Sanchez J.-C., Hochstrasser D.F., Williams K.L., Gooley A.A.Electrophoresis 19:837-844(1998) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006) Crystal structure of the membrane protein Ompc complex with antibacterial lactoferrin.Baalaji S., Acharya R.K., Singh T.P., Krishnaswamy S.Submitted (SEP-2006) to the PDB data bank

ncbi gi num :

16130152

ncbi acc num :

NP_416719.1

ncbi gb acc num :

NC_000913.3

uniprot acc num :

P06996

ncbi mol weight :

54.28kD

ncbi pathways :

Two-component System Pathway (1114); Two-component System Pathway (437); Beta-Lactam Resistance Pathway (1060015); Beta-Lactam Resistance Pathway (1084230)

ncbi summary :

Binds TrxA (Kumar, 2004). [More information is available at EcoGene: EG10670]. OmpC is a member of the GMP family. [More information is available at EcoCyc: EG10670].

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1170

more info or order :

MyBioSource product webpage