product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Influenza A virus Matrix protein 1 (M)
catalog :
MBS1256969
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
image
image 1 :
MyBioSource MBS1256969 image 1
product information
catalog number :
MBS1256969
products type :
Recombinant Protein
products full name :
Recombinant Influenza A virus Matrix protein 1 (M)
products short name :
[Matrix protein 1 (M)]
products name syn :
[Matrix protein 1; M1]
other names :
[Matrix protein 1; Matrix protein 1]
other gene names :
[M; M1]
uniprot entry name :
M1_I43A0
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-252. Full Length]
sequence :
MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDL
EALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRR
FVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIAL
SYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIAD
SQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGS
SEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLL
ENLQAYQKRMGVQMQRFK
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Influenza A virus (strain A/USA:Iowa/1943 H1N1)
products description :
Plays critical roles in virus replication, from virus entry and uncoating to assembly and budding of the virus particle. M1 binding to ribonucleocapsids (RNPs) in nucleus seems to inhibit viral transcription. Interaction of viral NEP with M1-RNP is thought to promote nuclear export of the complex, which is targeted to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA may bring M1, a non-raft-associated protein, into lipid rafts. Forms a continuous shell on the inner side of the lipid bilayer in virion, where it binds the RNP. During virus entry into cell, the M2 ion channel acidifies the internal virion core, inducing M1 dissociation from the RNP. M1-free RNPs are transported to the nucleus, where viral transcription and replication can take place. Determines the virion's shape: spherical or filamentous. Clinical isolates of influenza are characterized by the presence of significant proportion of filamentous virions, whereas after multiple passage on eggs or cell culture, virions have only spherical morphology. Filamentous virions are thought to be important to infect neighboring cells, and spherical virions more suited to spread through aerosol between hosts organisms
ncbi gi num :
229890350
ncbi acc num :
A4GCL0.1
uniprot acc num :
A4GCL0
ncbi mol weight :
11,178 Da
uniprot summary :
Plays critical roles in virus replication, from virus entry and uncoating to assembly and budding of the virus particle. M1 binding to ribonucleocapsids (RNPs) in nucleus seems to inhibit viral transcription. Interaction of viral NEP with M1-RNP is thought to promote nuclear export of the complex, which is targeted to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA may bring M1, a non-raft-associated protein, into lipid rafts. Forms a continuous shell on the inner side of the lipid bilayer in virion, where it binds the RNP. During virus entry into cell, the M2 ion channel acidifies the internal virion core, inducing M1 dissociation from the RNP. M1-free RNPs are transported to the nucleus, where viral transcription and replication can take place ().
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.05 mg (Yeast)
price4 :
795
size5 :
0.2 mg (E-Coli)
price5 :
855
size6 :
0.05 mg (Baculovirus)
price6 :
1005
size7 :
0.2 mg (Yeast)
price7 :
1065
size8 :
0.5 mg (E-Coli)
price8 :
1125
size9 :
0.5 mg (Yeast)
price9 :
1205
size10 :
0.05 mg (Mammalian-Cell)
price10 :
1245
size11 :
0.1 mg (Baculovirus)
price11 :
1450
size12 :
1 mg (E-Coli)
price12 :
1725
size13 :
0.5 mg (Baculovirus)
price13 :
1895
size14 :
1 mg (Yeast)
price14 :
1900
size15 :
0.1 mg (Mammalian-Cell)
price15 :
2030
size16 :
1 mg (Baculovirus)
price16 :
2940
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!