LIMPIVSKLFGGLDFSNYYVGLAGQAAGLPLAEAKKAGA
VFAYGNFITVALNFAILAFIIFLMIKQINRLKKDEPAAP
PAPPAEDIVLLREIRDALKK

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Pig Leptin receptor (LEPR), partial | MBS1256655
- Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast ...
- Recombinant Human Protein Mis18-beta (OIP5) | MBS1257470
- Recombinant Staphylococcus aureus Enterotoxin type H (entH) | MBS1263649
- Recombinant Protein E7 (E7) | MBS1264011