product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli Thioredoxin-2
catalog :
MBS1251239
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1251239
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Thioredoxin-2
products short name :
Thioredoxin-2
products name syn :
Protein-disulfide reductase
other names :
thioredoxin 2; Thioredoxin-2; thioredoxin 2; Protein-disulfide reductase
products gene name :
trxC
other gene names :
trxC; trxC; ECK2580; JW2566; yfiG; yfiG; Trx-2
uniprot entry name :
THIO2_ECOLI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-139
sequence length :
139
sequence :
MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDGEVIN
ATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVA
QERSGKVRFVKVNTEAERELSSRFGIRSIPTIMIFKNGQ
VVDMLNGAVPKAPFDSWLNESL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Efficient electron donor for the essential enzyme ribonucleotide reductase. Is also able to reduce the interchain disulfide bridges of insulin.
products references :
Cloning, expression, and characterization of a novel Escherichia coli thioredoxin.Miranda-Vizuete A., Damdimopoulos A.E., Gustafsson J.-A., Spyrou G.J. Biol. Chem. 272:30841-30847(1997) Construction of a contiguous 874-kb sequence of the Escherichia coli-K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features.Yamamoto Y., Aiba H., Baba T., Hayashi K., Inada T., Isono K., Itoh T., Kimura S., Kitagawa M., Makino K., Miki T., Mitsuhashi N., Mizobuchi K., Mori H., Nakade S., Nakamura Y., Nashimoto H., Oshima T., Oyama S., Saito N., Sampei G., Satoh Y., Sivasundaram S., Tagami H., Takahashi H., Takeda J., Takemoto K., Uehara K., Wada C., Yamagata S., Horiuchi T.DNA Res. 4:91-113(1997) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Non-ribosomal proteins affecting the assembly of ribosomes in Escherichia coli.Nashimoto H.(In) Nierhaus K.H. (eds.) ;The translational apparatus, pp.185-195, Plenum Press, New York (1993) Rudd K.E.Unpublished observations (NOV-1993)
ncbi gi num :
16130507
ncbi acc num :
NP_417077.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P0AGG4
ncbi mol weight :
31.54kD
ncbi summary :
OxyR regulon. [More information is available at EcoGene: EG11887]. The trxC gene encodes a second thioredoxin in Escherichia coli. [More information is available at EcoCyc: EG11887].
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!