product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Acyl-CoA desaturase 1 (Scd1)
catalog :
MBS1250174
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1250174
products type :
Recombinant Protein
products full name :
Recombinant Rat Acyl-CoA desaturase 1 (Scd1)
products short name :
Acyl-CoA desaturase 1 (Scd1)
products name syn :
Recombinant Acyl-CoA desaturase 1 (Scd1); Acyl-CoA desaturase 1 EC= 1.14.19.1; Delta(9)-desaturase 1; Delta-9 desaturase 1 Fatty acid desaturase 1 Stearoyl-CoA desaturase 1
other names :
acyl-CoA desaturase 1; Acyl-CoA desaturase 1; acyl-CoA desaturase 1; delta-9 desaturase 1; delta(9)-desaturase 1; fatty acid desaturase 1; stearoyl-CoA desaturase 1; stearoyl-Coenzyme A desaturase 1; Delta(9)-desaturase 1; Delta-9 desaturase 1; Fatty acid desaturase 1; Stearoyl-CoA desaturase 1
products gene name syn :
Scd1; Scd
other gene names :
Scd1; Scd1; Scd; Delta-9 desaturase 1
uniprot entry name :
ACOD1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
263-358, Partial, Provide the complete intracellular domain at the C-terminal.
sequence length :
358
sequence :
VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHH
AFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSK
AAVLARIKRTGDGSHKSS
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Rattus norvegicus (Rat)
ncbi gi num :
148747464
ncbi acc num :
NP_631931.2
ncbi gb acc num :
NM_139192.2
uniprot acc num :
P07308
ncbi mol weight :
41,467 Da
ncbi pathways :
Adipogenesis Pathway (198479); Biosynthesis Of Unsaturated Fatty Acids Pathway (83426); Biosynthesis Of Unsaturated Fatty Acids Pathway (429); Fatty Acid Biosynthesis Pathway (198539); PPAR Signaling Pathway (83434); PPAR Signaling Pathway (450); Oleate Biosynthesis II (animals And Fungi) Pathway (138576)
ncbi summary :
enzyme involved in the synthesis and regulation of unsaturated fatty acids [RGD, Feb 2006]
uniprot summary :
SCD: Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Belongs to the fatty acid desaturase family. Protein type: Membrane protein, integral; Endoplasmic reticulum; Membrane protein, multi-pass; EC 1.14.19.1; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis. Cellular Component: intracellular membrane-bound organelle; integral to endoplasmic reticulum membrane. Molecular Function: iron ion binding; stearoyl-CoA 9-desaturase activity. Biological Process: defense response to Gram-positive bacterium; lipid biosynthetic process; white fat cell differentiation; brown fat cell differentiation; fatty acid biosynthetic process
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!