product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Cathepsin S
catalog :
MBS1249669
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1249669
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cathepsin S
products short name :
Cathepsin S
other names :
cathepsin S isoform 2 preproprotein; Cathepsin S; cathepsin S; cathepsin S
products gene name :
ctss
other gene names :
Ctss; Ctss; Cats; Cats
uniprot entry name :
CATS_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
123-340; Mature full length protein;
sequence length :
340
sequence :
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLK
LKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQY
IIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQL
PFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDD
PSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQG
YIRMARNNKNHCGIASYCSYPEI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
products references :
Doh-ura K. Rommerskirch W. Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Cathepsin expression during skeletal development.Soederstroem M., Salminen H., Glumoff V., Kirschke H., Aro H., Vuorio E.Biochim. Biophys. Acta 1446:35-46(1999) Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697(1998)
ncbi gi num :
510025483
ncbi acc num :
NP_067256.4
ncbi gb acc num :
NM_021281.3
uniprot acc num :
O70370
ncbi mol weight :
27.8kD
ncbi pathways :
Adaptive Immune System Pathway (1323640); Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1323912); Collagen Formation Pathway (1323910); Degradation Of The Extracellular Matrix Pathway (1323922); Extracellular Matrix Organization Pathway (1323909); Immune System Pathway (1323639); Innate Immune System Pathway (1323671); Lysosome Pathway (99272)
ncbi summary :
This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, which encode preproproteins that are proteolytically processed to generate mature protein products. This enzyme is secreted by antigen-presenting cells during inflammation and may induce pain and itch via activation of G-protein coupled receptors. Homozygous knockout mice for this gene exhibit impaired wound healing, reduced tumorigenesis in a pancreatic cancer model, and reduced pathogenesis in a myasthenia gravis model. [provided by RefSeq, Aug 2015]
uniprot summary :
CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Protease; EC 3.4.22.27. Cellular Component: cell surface; extracellular space; intracellular membrane-bound organelle; lysosome; membrane. Molecular Function: collagen binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity; fibronectin binding; hydrolase activity; laminin binding; peptidase activity; proteoglycan binding. Biological Process: antigen processing and presentation; antigen processing and presentation of peptide antigen; bone resorption; collagen catabolic process; immune response; positive regulation of inflammatory response; protein processing; proteolysis; proteolysis involved in cellular protein catabolic process; regulation of sensory perception of pain; response to acidity
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
970
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!