Recombinant Mouse Cathepsin S | MyBioSource MBS1249669 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Cathepsin S

catalog :

MBS1249669

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1249669

products type :

Recombinant Protein

products full name :

Recombinant Mouse Cathepsin S

products short name :

Cathepsin S

other names :

cathepsin S isoform 2 preproprotein; Cathepsin S; cathepsin S; cathepsin S

products gene name :

ctss

other gene names :

Ctss; Ctss; Cats; Cats

uniprot entry name :

CATS_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

123-340; Mature full length protein;

sequence length :

340

sequence :

LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLK
LKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQY
IIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQL
PFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDD
PSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQG
YIRMARNNKNHCGIASYCSYPEI

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

products references :

Doh-ura K. Rommerskirch W. Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Cathepsin expression during skeletal development.Soederstroem M., Salminen H., Glumoff V., Kirschke H., Aro H., Vuorio E.Biochim. Biophys. Acta 1446:35-46(1999) Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697(1998)

ncbi gi num :

510025483

ncbi acc num :

NP_067256.4

ncbi gb acc num :

NM_021281.3

uniprot acc num :

O70370

ncbi mol weight :

27.8kD

ncbi pathways :

Adaptive Immune System Pathway (1323640); Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1323912); Collagen Formation Pathway (1323910); Degradation Of The Extracellular Matrix Pathway (1323922); Extracellular Matrix Organization Pathway (1323909); Immune System Pathway (1323639); Innate Immune System Pathway (1323671); Lysosome Pathway (99272)

ncbi summary :

This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, which encode preproproteins that are proteolytically processed to generate mature protein products. This enzyme is secreted by antigen-presenting cells during inflammation and may induce pain and itch via activation of G-protein coupled receptors. Homozygous knockout mice for this gene exhibit impaired wound healing, reduced tumorigenesis in a pancreatic cancer model, and reduced pathogenesis in a myasthenia gravis model. [provided by RefSeq, Aug 2015]

uniprot summary :

CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Protease; EC 3.4.22.27. Cellular Component: cell surface; extracellular space; intracellular membrane-bound organelle; lysosome; membrane. Molecular Function: collagen binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity; fibronectin binding; hydrolase activity; laminin binding; peptidase activity; proteoglycan binding. Biological Process: antigen processing and presentation; antigen processing and presentation of peptide antigen; bone resorption; collagen catabolic process; immune response; positive regulation of inflammatory response; protein processing; proteolysis; proteolysis involved in cellular protein catabolic process; regulation of sensory perception of pain; response to acidity

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

970

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage