protein

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5

MBS1247111

0.5 mg (Yeast)

750 USD

Recombinant Protein

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5

Leucine-rich repeat-containing G-protein coupled receptor 5

G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38

leucine-rich repeat-containing G-protein coupled receptor 5 isoform 2; Leucine-rich repeat-containing G-protein coupled receptor 5; leucine-rich repeat-containing G-protein coupled receptor 5; leucine-rich repeat containing G protein-coupled receptor 5; G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38

LGR5

LGR5; LGR5; FEX; HG38; GPR49; GPR67; GRP49; GPR49; GPR67

LGR5_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

22-561, Partial, provide the complete extracellular domain at the N-terminal

561

GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAG
NALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLR
SLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEI
PVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLH
LHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRT
LSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQ
FVGRSAFQHLPELRTLTLNGASQITEFPDLTGTANLESL
TLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSV
CQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIA
IIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKL
TGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAY
KISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLD
FEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIR

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cancer

Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a st cell marker of the intestinal epithelium and the hair follicle. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Involved in the development and/or maintenance of the adult intestinal st cells during postembryonic development.

Identification and cloning of an orphan G protein-coupled receptor of the glycoprotein hormone receptor subfamily.McDonald T., Wang R., Bailey W., Xie G., Chen F., Caskey C.T., Liu Q.Biochem. Biophys. Res. Commun. 247:266-270(1998) Characterization of two LGR genes homologous to gonadotropin and thyrotropin receptors with extracellular leucine-rich repeats and a G protein-coupled, seven-transmembrane region.Hsu S.Y., Liang S.-G., Hsueh A.J.W.Mol. Endocrinol. 12:1830-1845(1998) Alternatively spliced transcript of the GPR49-mRNA occur in different tumor cell lines and soft tissue sarcoma.Rot S., Taubert H., Bache M., Vordermark D., Kappler M.The finished DNA sequence of human chromosome 12.Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.Nature 440:346-351(2006) Overexpression of orphan G-protein-coupled receptor, Gpr49, in human hepatocellular carcinomas with beta-catenin mutations.Yamamoto Y., Sakamoto M., Fujii G., Tsuiji H., Kenetaka K., Asaka M., Hirohashi S.Hepatology 37:528-533(2003) Identification of overexpression of orphan G protein-coupled receptor GPR49 in human colon and ovarian primary tumors.McClanahan T., Koseoglu S., Smith K., Grein J., Gustafson E., Black S., Kirschmeier P., Samatar A.A.Cancer Biol. Ther. 5:419-426(2006) Immunostaining of Lgr5, an intestinal stem cell marker, in normal and premalignant human gastrointestinal tissue.Becker L., Huang Q., Mashimo H.ScientificWorldJournal 8:1168-1176(2008) LGR4 and LGR5 are R-spondin receptors mediating Wnt/beta-catenin and Wnt/PCP signalling.Glinka A., Dolde C., Kirsch N., Huang Y.L., Kazanskaya O., Ingelfinger D., Boutros M., Cruciat C.M., Niehrs C.EMBO Rep. 12:1055-1061(2011) Lgr5 homologues associate with Wnt receptors and mediate R-spondin signalling.de Lau W., Barker N., Low T.Y., Koo B.K., Li V.S., Teunissen H., Kujala P., Haegebarth A., Peters P.J., van de Wetering M., Stange D.E., van Es J.E., Guardavaccaro D., Schasfoort R.B., Mohri Y., Nishimori K., Mohammed S., Heck A.J., Clevers H.Nature 476:293-297(2011) R-spondins function as ligands of the orphan receptors LGR4 and LGR5 to regulate Wnt/beta-catenin signaling.Carmon K.S., Gong X., Lin Q., Thomas A., Liu Q.Proc. Natl. Acad. Sci. U.S.A. 108:11452-11457(2011) R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5.Ruffner H., Sprunger J., Charlat O., Leighton-Davies J., Grosshans B., Salathe A., Zietzling S., Beck V., Therier M., Isken A., Xie Y., Zhang Y., Hao H., Shi X., Liu D., Song Q., Clay I., Hintzen G., Tchorz J., Bouchez L.C., Michaud G., Finan P., Myer V.E., Bouwmeester T., Porter J., Hild M., Bassilana F., Parker C.N., Cong F.PLoS ONE 7:E40976-E40976(2012) Constitutive Internalization of the Leucine-rich G Protein-coupled Receptor-5 (LGR5) to the Trans-Golgi Network.Snyder J.C., Rochelle L.K., Lyerly H.K., Caron M.G., Barak L.S.J. Biol. Chem. 288:10286-10297(2013) Structure of stem cell growth factor R-spondin 1 in complex with the ectodomain of its receptor LGR5.Peng W.C., de Lau W., Forneris F., Granneman J.C., Huch M., Clevers H., Gros P.Cell Rep. 3:1885-1892(2013) The structural basis of R-spondin recognition by LGR5 and RNF43.Chen P.H., Chen X., Lin Z., Fang D., He X.Genes Dev. 27:1345-1350(2013)

469608414

NP_001264155.1

NM_001277226.1

O75473

62.37kD

Regulation Of FZD By Ubiquitination Pathway (1269607); Signal Transduction Pathway (1269379); Signaling By Wnt Pathway (1269594); TCF Dependent Signaling In Response To WNT Pathway (1269599)

The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

LGR5: a leucine-rich repeat-containing G-protein-coupled receptor. Receptor for R-spondins, potent stimulators of adult stem cell proliferation. A marker of cycling, long-lived and multipotent adult stem cell populations. Target gene of Wnt signaling. A Wnt receptor component that enhances Wnt signaling by soluble R-spondin proteins. Intestinal Lgr5+ stem cells give rise throughout life to proliferation of cells in crypts, which migrate along the crypt-villus axis, differentiating into five main cell types. Wnt signaling plays a crucial role in the proliferation and differentiation of these crypt epithelial cells. Two isoforms of the human protein are produced by alternative splicing. Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral. Chromosomal Location of Human Ortholog: 12q22-q23. Cellular Component: integral to plasma membrane; plasma membrane; trans-Golgi network membrane. Molecular Function: G-protein coupled receptor activity; protein binding; transmembrane receptor activity. Biological Process: G-protein coupled receptor protein signaling pathway; hair follicle development; inner ear development; oocyte differentiation; regulation of cell proliferation

0.5 mg (Yeast)

750 USD

0.5 mg (E-Coli)

950

0.05 mg (Baculovirus)

950

0.05 mg (Mammalian-Cell)

1170

1 mg (Yeast)

1180