product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Glucagon-like peptide 1 receptor
catalog :
MBS1246635
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1246635
products type :
Recombinant Protein
products full name :
Recombinant Mouse Glucagon-like peptide 1 receptor
products short name :
Glucagon-like peptide 1 receptor
products name syn :
GLP-1 receptor; GLP-1-R; GLP-1R
other names :
glucagon-like peptide 1 receptor; Glucagon-like peptide 1 receptor; glucagon-like peptide 1 receptor; glucagon-like peptide 1 receptor
products gene name :
Glp1r
other gene names :
Glp1r; Glp1r; GLP-1R; GLP1Rc; GLP-1 receptor; GLP-1-R; GLP-1R
uniprot entry name :
GLP1R_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-145; Partial, Provide the complete extracellular domain at the N-terminal.
sequence length :
145
sequence :
GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGL
FCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGH
VYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPE
EQLLSLY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Neuroscience
products description :
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
products references :
Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene." Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F. Diabetes 47:646-652(1998)
ncbi gi num :
111378379
ncbi acc num :
NP_067307.2
ncbi gb acc num :
NM_021332.2
uniprot acc num :
O35659
ncbi mol weight :
30.38kD
ncbi pathways :
Class B/2 (Secretin Family Receptors) Pathway (1324731); G Alpha (s) Signalling Events Pathway (1324736); GPCR Downstream Signaling Pathway (1324735); GPCR Ligand Binding Pathway (1324705); GPCRs, Class B Secretin-like Pathway (198364); Glucagon-like Peptide-1 (GLP1) Regulates Insulin Secretion Pathway (1324364); Glucagon-type Ligand Receptors Pathway (1324733); Insulin Secretion Pathway (777543); Integration Of Energy Metabolism Pathway (1324358); Metabolism Pathway (1324226)
uniprot summary :
GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2. Cellular Component: cytosol; integral to membrane; integral to plasma membrane; intracellular; membrane; plasma membrane. Molecular Function: G-protein coupled receptor activity; glucagon receptor activity; peptide hormone binding; peptide receptor activity; peptide receptor activity, G-protein coupled; receptor activity; signal transducer activity; transmembrane receptor activity. Biological Process: associative learning; cAMP-mediated signaling; cell surface receptor linked signal transduction; elevation of cytosolic calcium ion concentration; feeding behavior; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; hormone secretion; insulin secretion; learning and/or memory; memory; negative regulation of apoptosis; negative regulation of neuron apoptosis; neuropeptide signaling pathway; positive regulation of blood pressure; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of heart contraction; positive regulation of insulin secretion; positive regulation of transcription from RNA polymerase II promoter; regulation of calcium ion transport; regulation of heart contraction; release of sequestered calcium ion into cytosol; response to glucose stimulus; response to stress; signal transduction
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
860
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1085
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!