Recombinant Mouse Hemoglobin subunit beta-2 | MyBioSource MBS1246509 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Hemoglobin subunit beta-2

catalog :

MBS1246509

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1246509

products type :

Recombinant Protein

products full name :

Recombinant Mouse Hemoglobin subunit beta-2

products short name :

Hemoglobin subunit beta-2

products name syn :

Beta-2-globin; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain

other names :

hemoglobin subunit beta-2; Hemoglobin subunit beta-2; hemoglobin subunit beta-2; hemoglobin, beta adult minor chain; Beta-2-globin; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain

products gene name :

Hbb-b2

other gene names :

Hbb-b2; Hbb-b2; Hbb2; Hbbt2; beta2; AI036344

uniprot entry name :

HBB2_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-147

sequence length :

147

sequence :

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQ
RYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNL
DNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHH
LGKDFTPAAQAAFQKVVAGVATALAHKYH

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Involved in oxygen transport from the lung to the various peripheral tissues.

products references :

Nucleotide sequence of the BALB/c mouse beta-globin complex.Shehee W.R., Loeb D.D., Adey N.B., Burton F.H., Casavant N.C., Cole P., Davies C.J., McGraw R.A., Schichman S.A., Severynse D.M., Voliva C.F., Weyter F.W., Wisely G.B., Edgell M.H., Hutchison C.A. IIIJ. Mol. Biol. 205:41-62(1989) The evolution and sequence comparison of two recently diverged mouse chromosomal beta-globin genes.Konkel D.A., Maizel J.V. Jr., Leder P.Cell 18:865-873(1979) Mouse haemoglobin beta chains. Comparative sequence data on adult major and minor beta chains from two species, Mus musculus and Mus cervicolor.Gilman J.G.Biochem. J. 159:43-53(1976) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

ncbi gi num :

17647499

ncbi acc num :

NP_058652.1

ncbi gb acc num :

NM_016956.3

uniprot acc num :

P02089

ncbi mol weight :

43.1kD

ncbi pathways :

African Trypanosomiasis Pathway (194387); African Trypanosomiasis Pathway (194323); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1324545); Erythrocytes Take Up Carbon Dioxide And Release Oxygen Pathway (1324490); Erythrocytes Take Up Oxygen And Release Carbon Dioxide Pathway (1324491); Factors Involved In Megakaryocyte Development And Platelet Production Pathway (1323595); Hemostasis Pathway (1323559); Malaria Pathway (152666); Malaria Pathway (152657); Metabolism Pathway (1324226)

ncbi summary :

This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta-minor adult gene found in the "diffuse" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013]

uniprot summary :

HBB: Involved in oxygen transport from the lung to the various peripheral tissues. Defects in HBB may be a cause of Heinz body anemias (HEIBAN). This is a form of non-spherocytic hemolytic anemia of Dacie type 1. After splenectomy, which has little benefit, basophilic inclusions called Heinz bodies are demonstrable in the erythrocytes. Before splenectomy, diffuse or punctate basophilia may be evident. Most of these cases are probably instances of hemoglobinopathy. The hemoglobin demonstrates heat lability. Heinz bodies are observed also with the Ivemark syndrome (asplenia with cardiovascular anomalies) and with glutathione peroxidase deficiency. Defects in HBB are the cause of beta-thalassemia (B-THAL). A form of thalassemia. Thalassemias are common monogenic diseases occurring mostly in Mediterranean and Southeast Asian populations. The hallmark of beta-thalassemia is an imbalance in globin-chain production in the adult HbA molecule. Absence of beta chain causes beta(0)-thalassemia, while reduced amounts of detectable beta globin causes beta(+)-thalassemia. In the severe forms of beta-thalassemia, the excess alpha globin chains accumulate in the developing erythroid precursors in the marrow. Their deposition leads to a vast increase in erythroid apoptosis that in turn causes ineffective erythropoiesis and severe microcytic hypochromic anemia. Clinically, beta-thalassemia is divided into thalassemia major which is transfusion dependent, thalassemia intermedia (of intermediate severity), and thalassemia minor that is asymptomatic. Defects in HBB are the cause of sickle cell anemia (SKCA); also known as sickle cell disease. Sickle cell anemia is characterized by abnormally shaped red cells resulting in chronic anemia and periodic episodes of pain, serious infections and damage to vital organs. Normal red blood cells are round and flexible and flow easily through blood vessels, but in sickle cell anemia, the abnormal hemoglobin (called Hb S) causes red blood cells to become stiff. They are C-shaped and resembles a sickle. These stiffer red blood cells can led to microvascular occlusion thus cutting off the blood supply to nearby tissues. Defects in HBB are the cause of beta-thalassemia dominant inclusion body type (B-THALIB). An autosomal dominant form of beta thalassemia characterized by moderate anemia, lifelong jaundice, cholelithiasis and splenomegaly, marked morphologic changes in the red cells, erythroid hyperplasia of the bone marrow with increased numbers of multinucleate red cell precursors, and the presence of large inclusion bodies in the normoblasts, both in the marrow and in the peripheral blood after splenectomy. Belongs to the globin family. Protein type: Carrier. Cellular Component: hemoglobin complex. Molecular Function: heme binding; iron ion binding; metal ion binding; oxygen binding; oxygen transporter activity. Biological Process: erythrocyte development; oxygen transport; positive regulation of myeloid cell differentiation; regulation of erythrocyte differentiation; transport

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage