product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Simian immunodeficiency virus Protein Vpx
catalog :
MBS1246333
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1246333
products type :
Recombinant Protein
products full name :
Recombinant Simian immunodeficiency virus Protein Vpx
products short name :
Protein Vpx
products name syn :
Viral protein X; X ORF protein
other names :
Protein Vpx; Protein Vpx; Viral protein X; X ORF protein
products gene name :
vpx
other gene names :
vpx
uniprot entry name :
VPX_SIVSP
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-112
sequence length :
112
sequence :
MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNH
LPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKA
MFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
products references :
Sequence analysis and acute pathogenicity of molecularly cloned SIVSMM-PBj14.Dewhurst S., Embretson J.E., Anderson D.C., Mullins J.I., Fultz P.N.Nature 345:636-640(1990) Molecular clones from a non-acutely pathogenic derivative of SIVsmmPBj14 characterization and comparison to acutely pathogenic clones.Dewhurst S., Embretson J.E., Fultz P.N., Mullins J.I.AIDS Res. Hum. Retroviruses 8:1179-1187(1992) The human immunodeficiency virus type 2 Vpx protein usurps the CUL4A-DDB1 DCAF1 ubiquitin ligase to overcome a postentry block in macrophage infection.Bergamaschi A., Ayinde D., David A., Le Rouzic E., Morel M., Collin G., Descamps D., Damond F., Brun-Vezinet F., Nisole S., Margottin-Goguet F., Pancino G., Transy C.J. Virol. 83:4854-4860(2009) Structural basis of lentiviral subversion of a cellular protein degradation pathway.Schwefel D., Groom H.C., Boucherit V.C., Christodoulou E., Walker P.A., Stoye J.P., Bishop K.N., Taylor I.A.Nature 505:234-238(2014)
ncbi gi num :
139461
ncbi acc num :
P19508.1
uniprot acc num :
P19508
ncbi mol weight :
28.85kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
845
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1070
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!