IRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQY
GIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYN
EGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNK
VDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGN
SYGVCGLYTSSFYPVKN

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Escherichia coli Polyphosphate kinase (ppk) | MBS1248736
- Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA) | MBS1248970
- Recombinant Staphylococcus aureus Enterotoxin type E (entE) | MBS1250406
- Recombinant Outer membrane protein yopM (yopM) | MBS1251073
- Recombinant Polistes fuscatus Venom allergen 5 | MBS1252543
