product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human HLA class I histocompatibility antigen, alpha chain E
catalog :
MBS1243965
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1243965
products type :
Recombinant Protein
products full name :
Recombinant Human HLA class I histocompatibility antigen, alpha chain E
products short name :
HLA class I histocompatibility antigen, alpha chain E
products name syn :
MHC class I antigen E
other names :
HLA class I histocompatibility antigen, alpha chain E; HLA class I histocompatibility antigen, alpha chain E; HLA class I histocompatibility antigen, alpha chain E; major histocompatibility complex, class I, E; MHC class I antigen E
products gene name :
HLA-E
other gene names :
HLA-E; HLA-E; MHC; QA1; EA1.2; EA2.1; HLA-6.2; HLA-6.2; HLAE
uniprot entry name :
HLAE_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-305, Partial, provide the complete extracellular domain.
sequence length :
305
sequence :
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNL
RTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFA
YDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQ
RAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPIS
DHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETR
PAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLR
WKPASQPTIPI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products description :
Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.
products references :
Isolation and nucleotide sequence of a cDNA clone encoding a novel HLA class I gene.Mizuno S., Trapani J.A., Koller B.H., Dupont B., Yang S.Y.J. Immunol. 140:4024-4030(1988) Cell surface expression of HLA-E interaction with human beta-2 microglobulin and allelic differences.Ulbrecht M., Courturier A., Martinozzi S., Pla M., Srivastava R., Peterson P.A., Weiss E.H.3.0.CO;2-6>Eur. J. Immunol. 29:537-547(1999) HLA-E, F, and G polymorphism genomic sequence defines new variation spanning the nonclassical class I genes.Ishitani A., Miki A., Williams L.M., Moore Y., Geraghty D.E.Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H. HLA-E. A novel HLA class I gene expressed in resting T lymphocytes.Koller B.H., Geraghty D.E., Shimizu Y., Demars R., Orr H.T.J. Immunol. 141:897-904(1988) Ulbrecht M.A new variant of HLA-E*010303 with three synonymous mutations.He X., Xu L., Liu Y., Zeng Y.Cloning of HLA-E cDNA from activated peripheral leukocytes.He X., Xu L., Liu Y., Zeng Y.Polymorphism in the human class I MHC locus HLA-E in Japanese.Ohya K., Kondo K., Mizuno S.Immunogenetics 32:205-209(1990) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Structural features impose tight peptide binding specificity in the nonclassical MHC molecule HLA-E.O'Callaghan C.A., Tormo J., Willcox B.E., Braud V.M., Jakobsen B.K., Stuart D.I., McMichael A.J., Bell J.I., Jones E.Y.Mol. Cell 1:531-541(1998) Definitive high resolution typing of HLA-E allelic polymorphisms identifying potential errors in existing allele data.Grimsley C., Kawasaki A., Gassner C., Sageshima N., Nose Y., Hatake K., Geraghty D.E., Ishitani A.Tissue Antigens 60:206-212(2002)
ncbi gi num :
62912479
ncbi acc num :
NP_005507.3
ncbi gb acc num :
NP_005507.3
uniprot acc num :
P13747
ncbi mol weight :
48.67kD
ncbi pathways :
Adaptive Immune System Pathway (1269171); Allograft Rejection Pathway (920963); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway (1269194); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); Antigen Processing-Cross Presentation Pathway (1269195); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533)
ncbi summary :
HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008]
uniprot summary :
HLA-E: Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules. Belongs to the MHC class I family. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 6p21.3. Cellular Component: cell surface; early endosome membrane; Golgi membrane; MHC class I protein complex; phagocytic vesicle membrane; plasma membrane. Molecular Function: beta-2-microglobulin binding; MHC class I protein binding; natural killer cell lectin-like receptor binding; peptide antigen binding; receptor binding. Biological Process: adaptive immune response; antibacterial humoral response; antigen processing and presentation of endogenous peptide antigen via MHC class Ib; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; defense response to Gram-positive bacterium; innate immune response; positive regulation of immunoglobulin secretion; positive regulation of interleukin-13 production; positive regulation of interleukin-4 production; positive regulation of natural killer cell mediated immunity; positive regulation of T cell mediated cytotoxicity; positive regulation of TRAIL production; positive regulation of tumor necrosis factor production; protection from natural killer cell mediated cytotoxicity; regulation of immune response; regulation of natural killer cell mediated immunity
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!