product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Enterobacteria phage M13 Tail virion protein G7P (VII), partial
catalog :
MBS1242856
quantity :
1 mg (E-Coli)
price :
990 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1242856 image 1
Enterobacteria phage M13 Tail virion protein G7P (VII) . Gst-tagged
product information
catalog number :
MBS1242856
products type :
Recombinant Protein
products full name :
Recombinant Enterobacteria phage M13 Tail virion protein G7P (VII), partial
products short name :
[Tail virion protein G7P (VII)]
other names :
[phage assembly protein; Tail virion protein G7P; minor coat protein; Coat protein C, polypeptide I; Gene 7 protein; G7P]
products gene name :
[VII]
other gene names :
[VII; VII; G7P]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-33]
sequence length :
33
sequence :
MEQVADFDTIYQAMIQISVVLCFALGIIAGGQR
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Enterobacteria phage M13 (Bacteriophage M13)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
ncbi gi num :
17426221
ncbi acc num :
NP_510888.1
ncbi gb acc num :
NC_003287.2
uniprot acc num :
P69535
ncbi mol weight :
3,602 Da
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
May initiate with G9P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
size1 :
1 mg (E-Coli)
price1 :
990 USD
size2 :
1 mg (Yeast)
price2 :
1450
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!