catalog number :
MBS1238440
products type :
Recombinant Protein
products full name :
Recombinant Enterobacteria phage MS2 Capsid protein
products short name :
[Capsid protein]
other names :
[coat protein; Capsid protein; coat protein; Coat protein]
other gene names :
[cp; CP; CP]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-130. Full Length of Mature Protein]
sequence :
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRS
QAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELP
VAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNP
IPSAIAANSGIY
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Enterobacteria phage MS2 (Bacteriophage MS2)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi acc num :
NP_040648.1
ncbi gb acc num :
NC_001417.2
ncbi mol weight :
13,860 Da
uniprot summary :
Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins) (PubMed:8254664, PubMed:18662904). Involved in viral genome encapsidation through the interaction between a capsid protein dimer and the multiple packaging signals present in the RNA genome (PubMed:9469847, PubMed:26608810, PubMed:7523953). The capsid contains also 1 copy of the A2 maturation protein (PubMed:8254664).
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)