protein

Recombinant Mouse Baculoviral IAP repeat-containing protein 5

MBS1238412

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Baculoviral IAP repeat-containing protein 5

Baculoviral IAP repeat-containing protein 5

Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP

baculoviral IAP repeat-containing protein 5 isoform 3; Baculoviral IAP repeat-containing protein 5; baculoviral IAP repeat-containing protein 5; baculoviral IAP repeat-containing 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP

Birc5

Birc5; Birc5; Api4; TIAP; AAC-11; survivin40; Api4; Iap4

BIRC5_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

1-140

121

MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMA
EAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHR
KHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKET
NNKQKEFEETAKTTRQSIEQLAA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movent to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.

Mammalian inhibitor of apoptosis (IAP) homolog.Uren A.G., Vaux D.L.Kobayashi K., Otaki M., Ogasawara T., Tokuhisa T. Three differentially expressed survivin cDNA variants encode proteins with distinct antiapoptotic functions.Conway E.M., Pollefeyt S., Cornelissen J., DeBaere I., Steiner-Mosonyi M., Ong K., Baens M., Collen D., Schuh A.C.Blood 95:1435-1442(2000) Crystal structure and mutagenic analysis of the inhibitor-of-apoptosis protein survivin.Muchmore S.W., Chen J., Jakob C., Zakula D., Matayoshi E.D., Wu W., Zhang H., Li F., Ng S.C., Altieri D.C.Mol. Cell 6:173-182(2000)

59859890

NP_001012273.1

NM_001012273.1

O70201

32.3kD

Apoptosis Pathway (198339); Cell Cycle Pathway (1323926); Cell Cycle, Mitotic Pathway (1323946); Colorectal Cancer Pathway (83299); Colorectal Cancer Pathway (518); Hepatitis B Pathway (694729); Hippo Signaling Pathway (749786); Hippo Signaling Pathway (750388); IL-3 Signaling Pathway (198420); M Phase Pathway (1323991)

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. In humans, gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts have been identified in human that regulate this gene's expression. At least three transcript variants encoding distinct isoforms have been found for this gene, although at least one of these transcript variants is a nonsense-mediated decay (NMD) candidate. [provided by RefSeq, Jul 2008]

Survivin: an apoptosis inhibitor that is expressed during the G2/M phase of the cell cycle. Associates with the microtubules of the mitotic spindle and any disruption results in the loss of apoptosis activity. May play a role in neoplasia. Inhibitor of caspase-3 and caspase-7. Two splice variant isoforms have been described. Protein type: Apoptosis. Cellular Component: apical plasma membrane; centriole; chromosome; chromosome, pericentric region; cytoplasm; cytoplasmic microtubule; cytoskeleton; cytosol; interphase microtubule organizing center; kinetochore; microtubule; midbody; nuclear chromosome; nucleus; spindle microtubule. Molecular Function: caspase inhibitor activity; chaperone binding; cofactor binding; cysteine protease inhibitor activity; enzyme binding; identical protein binding; metal ion binding; microtubule binding; protease inhibitor activity; protein binding; protein heterodimerization activity; protein homodimerization activity; Ran GTPase binding; tubulin binding; ubiquitin-protein ligase activity; zinc ion binding. Biological Process: apoptosis; cell cycle; cell division; chromosome segregation; cytokinesis; embryonic development; establishment of chromosome localization; G2/M transition of mitotic cell cycle; microtubule cytoskeleton organization and biogenesis; mitosis; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of neuron apoptosis; negative regulation of peptidase activity; negative regulation of transcription, DNA-dependent; positive regulation of cell cycle; positive regulation of exit from mitosis; positive regulation of mitotic cell cycle; protein amino acid phosphorylation; protein complex localization; regulation of mitotic cell cycle; regulation of signal transduction; regulation of transcription, DNA-dependent; spindle checkpoint; transcription, DNA-dependent

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750