YNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGK
TGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTS
TNLLNWTLTDQF

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse Baculoviral IAP repeat-containing protein 5 | MBS1238412
- Recombinant Yersinia pestis (strain Pestoides F) 60 kDa chaperonin | MBS1238436
- Recombinant Human Golgi integral membrane protein 4 (GOLIM4) | MBS1239054
- Recombinant Ba(Mycobacterium tuberculosis) ESAT-6-like protein esxB | MBS1239697
- Recombinant Human Syntaxin-10 | MBS1239918
