product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human herpesvirus 1 Thymidine kinase
catalog :
MBS1237171
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1237171
products type :
Recombinant Protein
products full name :
Recombinant Human herpesvirus 1 Thymidine kinase
products short name :
Thymidine kinase
other names :
thymidine kinase; Thymidine kinase; involved in nucleotide metabolism; thymidine kinase
products gene name :
TK
other gene names :
UL23; TK
uniprot entry name :
KITH_HHV11
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-376, Full length.
sequence length :
376
sequence :
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQEATE
VRPEQKMPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI
VYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDA
AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPA
LTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIP
PTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
IRRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPPQGAE
PQSNAGPRPHIGDTLFTLFRAPELLAPNGDLYNVFAWAL
DVLAKRLRSMHVFILDYDQSPAGCRDALLQLTSGMVQTH
VTTPGSIPTICDLARTFAREMGEAN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
In latent infection, may allow the virus to be reactivated and to grow in cells lacking a high concentration of phosphorylated nucleic acid precursors, such as nerve cells that do not replicate their genome.
products references :
The nucleotide sequence and transcript map of the herpes simplex virus thymidine kinase gene.McKnight S.L.Nucleic Acids Res. 8:5949-5964(1980) The complete DNA sequence of the long unique region in the genome of herpes simplex virus type 1.McGeoch D.J., Dalrymple M.A., Davison A.J., Dolan A., Frame M.C., McNab D., Perry L.J., Scott J.E., Taylor P.J. Gen. Virol. 69:1531-1574(1988) The three-dimensional structure of thymidine kinase from herpes simplex virus type 1.Wild K., Bohner T., Aubry A., Folkers G., Schulz G.E.FEBS Lett. 368:289-292(1995) Crystal structures of the thymidine kinase from herpes simplex virus type-1 in complex with deoxythymidine and ganciclovir.Brown D.G., Visse R., Sandhu G., Davies A., Rizkallah P.J., Melitz C., Summers W.C., Sanderson M.R.Nat. Struct. Biol. 2:876-881(1995) The structures of thymidine kinase from herpes simplex virus type 1 in complex with substrates and a substrate analogue.Wild K., Bohner T., Folkers G., Schulz G.E.Protein Sci. 6:2097-2106(1997) Exploring the active site of herpes simplex virus type-1 thymidine kinase by X-ray crystallography of complexes with aciclovir and other ligands.Champness J.N., Bennett M.S., Wien F., Visse R., Summers W.C., Herdewijn P., de Clerq E., Ostrowski T., Jarvest R.L., Sanderson M.R.3.0.CO;2-8>Proteins 32:350-361(1998) Structure to 1.9-A resolution of a complex with herpes simplex virus type-1 thymidine kinase of a novel, non-substrate inhibitor X-ray crystallographic comparison with binding of aciclovir.Bennett M.S., Wien F., Champness J.N., Batuwangala T., Rutherford T., Summers W.C., Sun H., Wright G., Sanderson M.R.FEBS Lett. 443:121-125(1999) Nucleoside binding site of herpes simplex type 1 thymidine kinase analyzed by X-ray crystallography.Vogt J., Perozzo R., Pautsch A., Prota A., Schelling P., Pilger B., Folkers G., Scapozza L., Schulz G.E.3.0.CO;2-8>Proteins 41:545-553(2000)
ncbi gi num :
820945252
ncbi acc num :
YP_009137097.1
ncbi gb acc num :
NC_001806.2
uniprot acc num :
P03176
ncbi mol weight :
45kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!