catalog number :
MBS1236827
products type :
Recombinant Protein
products full name :
Recombinant strain K12 Methyl-accepting chemotaxis protein I
products short name :
strain K12 Methyl-accepting chemotaxis protein I
products name syn :
Serine chemoreceptor protein
other names :
methyl-accepting chemotaxis protein I, serine sensor receptor; Methyl-accepting chemotaxis protein I; methyl-accepting chemotaxis protein I, serine sensor receptor; Serine chemoreceptor protein
other gene names :
tsr; tsr; cheD; ECK4345; JW4318; cheD; MCP-I
uniprot entry name :
MCP1_ECOLI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
211-551
sequence :
WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEM
GQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGN
NDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQAS
HLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIIS
VIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRN
LAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAE
IVSAVTRVTDIMGEIASASDE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids. Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.
products references :
Structure of the serine chemoreceptor in Escherichia coli.Boyd A., Kendall K., Simon M.I.Nature 301:623-626(1983)
Analysis of the Escherichia coli genome VI
DNA sequence of the region from 92.8 through 100 minutes.Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
The Escherichia coli C homoprotocatechuate degradative operon
hpc gene order, direction of transcription and control of expression.Roper D.I., Fawcett T., Cooper R.A.Mol. Gen. Genet. 237:241-250(1993)
The methyl-accepting chemotaxis proteins of Escherichia coli. Identification of the multiple methylation sites on methyl-accepting chemotaxis protein I.Kehry M.R., Dahlquist F.W.J. Biol. Chem. 257:10378-10386(1982)
Sites of deamidation and methylation in Tsr, a bacterial chemotaxis sensory transducer.Rice M.S., Dahlquist F.W.J. Biol. Chem. 266:9746-9753(1991)
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997)
Global topology analysis of the Escherichia coli inner membrane proteome.Daley D.O., Rapp M., Granseth E., Melen K., Drew D., von Heijne G.Science 308:1321-1323(2005)
Isolation and identification of new inner membrane-associated proteins that localize to cell poles in Escherichia coli.Li G., Young K.D.Mol. Microbiol. 84:276-295(2012)
Four-helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor.Kim K.K., Yokota H., Kim S.-H.Nature 400:787-792(1999)
ncbi acc num :
NP_418775.1
ncbi gb acc num :
NP_418775.1
ncbi pathways :
Bacterial Chemotaxis Pathway (1116); Bacterial Chemotaxis Pathway (438); Two-component System Pathway (1114); Two-component System Pathway (437)
ncbi summary :
Tsr also senses energy levels and is involved in aerotaxis, redox taxis and glycerol repellent taxis. [More information is available at EcoGene: EG11034]. Tsr is a serine chemoreceptor in Escherichia coli and binds directly to the MCP periplasmic domain. [More information is available at EcoCyc: EG11034].