Recombinant strain K12 Methyl-accepting chemotaxis protein I | MyBioSource MBS1236827 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant strain K12 Methyl-accepting chemotaxis protein I

catalog :

MBS1236827

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1236827

products type :

Recombinant Protein

products full name :

Recombinant strain K12 Methyl-accepting chemotaxis protein I

products short name :

strain K12 Methyl-accepting chemotaxis protein I

products name syn :

Serine chemoreceptor protein

other names :

methyl-accepting chemotaxis protein I, serine sensor receptor; Methyl-accepting chemotaxis protein I; methyl-accepting chemotaxis protein I, serine sensor receptor; Serine chemoreceptor protein

products gene name :

tsr

other gene names :

tsr; tsr; cheD; ECK4345; JW4318; cheD; MCP-I

uniprot entry name :

MCP1_ECOLI

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

211-551

sequence length :

551

sequence :

WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEM
GQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGN
NDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQAS
HLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIIS
VIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRN
LAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAE
IVSAVTRVTDIMGEIASASDE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids. Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.

products references :

Structure of the serine chemoreceptor in Escherichia coli.Boyd A., Kendall K., Simon M.I.Nature 301:623-626(1983) Analysis of the Escherichia coli genome VI DNA sequence of the region from 92.8 through 100 minutes.Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The Escherichia coli C homoprotocatechuate degradative operon hpc gene order, direction of transcription and control of expression.Roper D.I., Fawcett T., Cooper R.A.Mol. Gen. Genet. 237:241-250(1993) The methyl-accepting chemotaxis proteins of Escherichia coli. Identification of the multiple methylation sites on methyl-accepting chemotaxis protein I.Kehry M.R., Dahlquist F.W.J. Biol. Chem. 257:10378-10386(1982) Sites of deamidation and methylation in Tsr, a bacterial chemotaxis sensory transducer.Rice M.S., Dahlquist F.W.J. Biol. Chem. 266:9746-9753(1991) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Global topology analysis of the Escherichia coli inner membrane proteome.Daley D.O., Rapp M., Granseth E., Melen K., Drew D., von Heijne G.Science 308:1321-1323(2005) Isolation and identification of new inner membrane-associated proteins that localize to cell poles in Escherichia coli.Li G., Young K.D.Mol. Microbiol. 84:276-295(2012) Four-helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor.Kim K.K., Yokota H., Kim S.-H.Nature 400:787-792(1999)

ncbi gi num :

16132176

ncbi acc num :

NP_418775.1

ncbi gb acc num :

NP_418775.1

uniprot acc num :

P02942

ncbi mol weight :

37.9kD

ncbi pathways :

Bacterial Chemotaxis Pathway (1116); Bacterial Chemotaxis Pathway (438); Two-component System Pathway (1114); Two-component System Pathway (437)

ncbi summary :

Tsr also senses energy levels and is involved in aerotaxis, redox taxis and glycerol repellent taxis. [More information is available at EcoGene: EG11034]. Tsr is a serine chemoreceptor in Escherichia coli and binds directly to the MCP periplasmic domain. [More information is available at EcoCyc: EG11034].

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

1 mg (Yeast)

price5 :

1850

more info or order :

MyBioSource product webpage