SVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEAN
LGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLT
VKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD
YN

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Oncorhynchus mykiss Myelin proteolipid protein | MBS1236514
- Recombinant strain K12 Methyl-accepting chemotaxis protein I | MBS1236827
- Recombinant Human Beta-1 adrenergic receptor | MBS1236894
- Recombinant Human herpesvirus 1 Thymidine kinase | MBS1237171
- Recombinant Bacillus sp. (strain L7) Levanase | MBS1237357
