SFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKV
DLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSR
FNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFK
APTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTN
YLTCHNAAQCDCLCTPDPIT

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Marmota monax (Woodchuck) Interferon gamma | MBS1234379
- Recombinant Rat Prolactin-inducible protein homolog | MBS1234418
- Recombinant Dog Tight junction protein ZO-1 | MBS1235259
- Recombinant Escherichia coli Peptide deformylase | MBS1238309
- Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2) | MBS1240208
