product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli NAD (P) transhydrogenase subunit beta
catalog :
MBS1233184
quantity :
1 mg (E-Coli)
price :
1975 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1233184
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli NAD (P) transhydrogenase subunit beta
products short name :
NAD (P) transhydrogenase subunit beta
products name syn :
Recombinant NAD (P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunit beta EC= 1.6.1.2; Nicotinamide nucleotide transhydrogenase subunit beta Pyridine nucleotide transhydrogenase subunit beta
other names :
pyridine nucleotide transhydrogenase, beta subunit; NAD(P) transhydrogenase subunit beta; pyridine nucleotide transhydrogenase, beta subunit; Nicotinamide nucleotide transhydrogenase subunit beta; Pyridine nucleotide transhydrogenase subunit beta
products gene name syn :
pntB
other gene names :
pntB; pntB; ECK1597; JW1594
uniprot entry name :
PNTB_ECOLI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
330-462
sequence :
TEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDI
VLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIA
GMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHM
LFGDAKASVDILKAL
purity :
>90% (SDS-PAGE)
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Escherichia coli (strain K12)
products description :
The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane.
ncbi gi num :
16129560
ncbi acc num :
NP_416119.1
ncbi gb acc num :
NC_000913.2
uniprot acc num :
P0AB67
ncbi mol weight :
32 kDa
ncbi pathways :
Metabolic Pathways (131985); NAD Phosphorylation And Dephosphorylation Pathway (66); NAD Phosphorylation And Dephosphorylation Pathway (138363); Nicotinate And Nicotinamide Metabolism Pathway (1092); Nicotinate And Nicotinamide Metabolism Pathway (400)
ncbi summary :
[More information is available at EcoGene: EG10745]. PntB is an inner membrane protein with nine predicted transmembrane domains. [More information is available at EcoCyc: EG10745].
uniprot summary :
Function: The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane. Catalytic activity: NADPH + NAD+ = NADP+ + NADH. Subunit structure: Heterodimer of an alpha and a beta chain. Subcellular location: Cell inner membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the PNT beta subunit family.
size1 :
1 mg (E-Coli)
price1 :
1975 USD
size2 :
1 mg (Yeast)
price2 :
2435
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!