catalog number :
MBS1233003
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Hygromycin-B 4-O-kinase
products short name :
[Hygromycin-B 4-O-kinase]
products name syn :
[APH(4)Hygromycin B phosphotransferase; Hygromycin-B kinase]
other names :
[MULTISPECIES: aminoglycoside O-phosphotransferase APH(4)-Ia; Hygromycin-B 4-O-kinase; confers hygromycin resistance; APH(4); Hygromycin B phosphotransferase; Hygromycin-B kinase]
products gene name :
[hph]
other gene names :
[PWD4IncI1_10; hph]
uniprot entry name :
KHYB_ECOLX
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-341aa; Full Length]
sequence :
MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSF
DVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVL
DIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAE
AMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIAD
PHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLV
HADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFF
WRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQ
LYQSLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARR
SAAVWTDGCVEVLADSGNRRPSTRPRAKE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation. Only phosphorylates hygromycin and closely related compounds such as dethyl analogs and destomycin.
products references :
Analysis of a bacterial hygromycin B resistance gene by transcriptional and translational fusions and by DNA sequencing.Kaster K.R., Burgett S.G., Rao R.N., Ingolia T.D.Nucleic Acids Res. 11:6895-6911(1983)
Genetic and enzymatic basis of hygromycin B resistance in Escherichia coli.Rao R.N., Allen N.E., Hobbs J.N. Jr., Alborn W.E. Jr., Kirst H.A., Paschal J.W.Antimicrob. Agents Chemother. 24:689-695(1983)
ncbi acc num :
WP_000742814.1
ncbi gb acc num :
WP_000742814.1
uniprot summary :
The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation. Only phosphorylates hygromycin and closely related compounds such as demethyl analogs and destomycin.