product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Suppressor of cytokine signaling 1
catalog :
MBS1231200
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS1231200
products type :
Recombinant Protein
products full name :
Recombinant Human Suppressor of cytokine signaling 1
products short name :
Suppressor of cytokine signaling 1
products name syn :
JAK-binding protein; JABSTAT-induced STAT inhibitor 1; SSI-1; Tec-interacting protein 3; TIP-3
other names :
suppressor of cytokine signaling 1; Suppressor of cytokine signaling 1; suppressor of cytokine signaling 1; suppressor of cytokine signaling 1; JAK-binding protein; JAB; STAT-induced STAT inhibitor 1; SSI-1; Tec-interacting protein 3; TIP-3
products gene name :
SOCS1
other gene names :
SOCS1; SOCS1; JAB; CIS1; SSI1; TIP3; CISH1; SSI-1; SOCS-1; SSI1; TIP3; SOCS-1; JAB; SSI-1; TIP-3
uniprot entry name :
SOCS1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-211; Full length
sequence length :
211
sequence :
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARP
RPCPAVPAPAPGDTHFRTFRSHADYRRITRASALLDACG
FYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSV
KMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
APRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIP
LNPVLRDYLSSFPFQI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products description :
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway.
products references :
Cloning and functional analysis of new members of STAT induced STAT inhibitor (SSI) family SSI-2 and SSI-3.Minamoto S., Ikegame K., Ueno K., Narazaki M., Naka T., Yamamoto H., Matsumoto T., Saito H., Hosoe S., Kishimoto T.Biochem. Biophys. Res. Commun. 237:79-83(1997) SOCS-1/JAB/SSI-1 can bind to and suppress Tec protein-tyrosine kinase.Ohya K., Kajigaya S., Yamashita Y., Miyazato A., Hatake K., Miura Y., Ikeda U., Shimada K., Ozawa K., Mano H.J. Biol. Chem. 272:27178-27182(1997) A family of cytokine-inducible inhibitors of signaling.Starr R., Willson T.A., Viney E.M., Murray L.J.L., Rayner J.R., Jenkins B.J., Gonda T.J., Alexander W.S., Metcalf D., Nicola N.A., Hilton D.J.Nature 387:917-921(1997) Radiation hybrid and cytogenetic mapping of SOCS1 and SOCS2 to chromosomes 16p13 and 12q, respectively.Yandava C.N., Pillari A., Drazen J.M.Genomics 61:108-111(1999) Schlueter G.A new protein containing an SH2 domain that inhibits JAK kinases.Endo T.A., Masuhara M., Yokouchi M., Suzuki R., Sakamoto H., Mitsui K., Matsumoto A., Tanimura S., Ohtsubo M., Misawa H., Miyazaki T., Leonor N., Taniguchi T., Fujita T., Kanakura Y., Komiya S., Yoshimura A.Nature 387:921-924(1997) Interaction of human suppressor of cytokine signaling (SOCS) -2 with the insulin-like growth factor-I receptor.Dey B.R., Spence S.L., Nissley P., Furlanetto R.W.J. Biol. Chem. 273:24095-24101(1998) The SOCS box of SOCS-1 accelerates ubiquitin-dependent proteolysis of TEL-JAK2.Kamizono S., Hanada T., Yasukawa H., Minoguchi S., Kato R., Minoguchi M., Hattori K., Hatakeyama S., Yada M., Morita S., Kitamura T., Kato H., Nakayama K.I., Yoshimura A.J. Biol. Chem. 276:12530-12538(2001) Socs-1 inhibits TEL-JAK2-mediated transformation of hematopoietic cells through inhibition of JAK2 kinase activity and induction of proteasome-mediated degradation.Frantsve J., Schwaller J., Sternberg D.W., Kutok J., Gilliland D.G.Mol. Cell. Biol. 21:3547-3557(2001) SOCS proteins negative regulators of cytokine signaling.Krebs D.L., Hilton D.J.Stem Cells 19:378-387(2001) Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin.Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.Biochem. Biophys. Res. Commun. 299:793-800(2002) Cytokine signaling in the brain putting a SOCS in it?Wang J., Campbell I.L.J. Neurosci. Res. 67:423-427(2002) Suppressors of cytokine signaling (SOCS) 1 and SOCS3 interact with and modulate fibroblast growth factor receptor signaling.Ben-Zvi T., Yayon A., Gertler A., Monsonego-Ornan E.J. Cell Sci. 119:380-387(2006)
ncbi gi num :
4507233
ncbi acc num :
NP_003736.1
ncbi gb acc num :
NP_003736.1
uniprot acc num :
O15524
ncbi mol weight :
27.6kD
ncbi pathways :
Activated TLR4 Signalling Pathway (1269236); Adaptive Immune System Pathway (1269171); Adipogenesis Pathway (198832); Antigen Processing: Ubiquitination Proteasome Degradation Pathway (1269193); Class I MHC Mediated Antigen Processing Presentation Pathway (1269192); Cytokine Signaling In Immune System Pathway (1269310); ECS Complex Pathway (413455); ECS Complex Pathway (468394); EGFR1 Signaling Pathway (198782); EPO Receptor Signaling Pathway (198882)
ncbi summary :
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including IL2, IL3 erythropoietin (EPO), CSF2/GM-CSF, and interferon (IFN)-gamma. The protein encoded by this gene functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. [provided by RefSeq, Jul 2008]
uniprot summary :
SOCS1: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein- tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway. Interacts with multiple activated signaling proteins of the tyrosine kinase signaling pathway including JAK family kinases, TEC, KIT, GRB2 and VAV. Binding to JAKs is mediated through the KIR and SH2 domains to a phosphorylated tyrosine residue within the JAK JH1 domain. Binds the SH3 domain of GRB2 via diproline determinants in the N-terminus, and the N-terminal regulatory domain of VAV. Interacts with the Elongin BC complex (TCEB1 and TCEB2). Component of an ECS CBC(SOCS1) E3 ubiquitin-protein ligase complex which contains Elongin BC, CUL5, RBX1 and SOCS1. Interacts (via SH2 domain and SOCS box) with TRIM8. Interacts with AXL, CUL2 and FGFR3. Interacts with INSR. By a subset of cytokines including those belonging to the interferon, interleukin and colony-stimulating factor families. Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes. Protein type: Inhibitor. Chromosomal Location of Human Ortholog: 16p13.13. Cellular Component: cytoplasm; cytoplasmic membrane-bound vesicle; cytosol; nucleus. Molecular Function: insulin-like growth factor receptor binding; kinase inhibitor activity; protein binding; protein kinase binding; protein kinase inhibitor activity. Biological Process: cytokine and chemokine mediated signaling pathway; fat cell differentiation; JAK-STAT cascade; negative regulation of insulin receptor signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of tyrosine phosphorylation of Stat3 protein; organ regeneration; protein ubiquitination; regulation of cytokine secretion; regulation of growth; regulation of protein amino acid phosphorylation; regulation of tyrosine phosphorylation of Stat1 protein; response to drug; response to estradiol stimulus; response to lipopolysaccharide; response to progesterone stimulus
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!