protein

Recombinant Human Suppressor of cytokine signaling 1

MBS1231200

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Suppressor of cytokine signaling 1

Suppressor of cytokine signaling 1

JAK-binding protein; JABSTAT-induced STAT inhibitor 1; SSI-1; Tec-interacting protein 3; TIP-3

suppressor of cytokine signaling 1; Suppressor of cytokine signaling 1; suppressor of cytokine signaling 1; suppressor of cytokine signaling 1; JAK-binding protein; JAB; STAT-induced STAT inhibitor 1; SSI-1; Tec-interacting protein 3; TIP-3

SOCS1

SOCS1; SOCS1; JAB; CIS1; SSI1; TIP3; CISH1; SSI-1; SOCS-1; SSI1; TIP3; SOCS-1; JAB; SSI-1; TIP-3

SOCS1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-211; Full length

211

MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARP
RPCPAVPAPAPGDTHFRTFRSHADYRRITRASALLDACG
FYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSV
KMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
APRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIP
LNPVLRDYLSSFPFQI

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway.

Cloning and functional analysis of new members of STAT induced STAT inhibitor (SSI) family SSI-2 and SSI-3.Minamoto S., Ikegame K., Ueno K., Narazaki M., Naka T., Yamamoto H., Matsumoto T., Saito H., Hosoe S., Kishimoto T.Biochem. Biophys. Res. Commun. 237:79-83(1997) SOCS-1/JAB/SSI-1 can bind to and suppress Tec protein-tyrosine kinase.Ohya K., Kajigaya S., Yamashita Y., Miyazato A., Hatake K., Miura Y., Ikeda U., Shimada K., Ozawa K., Mano H.J. Biol. Chem. 272:27178-27182(1997) A family of cytokine-inducible inhibitors of signaling.Starr R., Willson T.A., Viney E.M., Murray L.J.L., Rayner J.R., Jenkins B.J., Gonda T.J., Alexander W.S., Metcalf D., Nicola N.A., Hilton D.J.Nature 387:917-921(1997) Radiation hybrid and cytogenetic mapping of SOCS1 and SOCS2 to chromosomes 16p13 and 12q, respectively.Yandava C.N., Pillari A., Drazen J.M.Genomics 61:108-111(1999) Schlueter G.A new protein containing an SH2 domain that inhibits JAK kinases.Endo T.A., Masuhara M., Yokouchi M., Suzuki R., Sakamoto H., Mitsui K., Matsumoto A., Tanimura S., Ohtsubo M., Misawa H., Miyazaki T., Leonor N., Taniguchi T., Fujita T., Kanakura Y., Komiya S., Yoshimura A.Nature 387:921-924(1997) Interaction of human suppressor of cytokine signaling (SOCS) -2 with the insulin-like growth factor-I receptor.Dey B.R., Spence S.L., Nissley P., Furlanetto R.W.J. Biol. Chem. 273:24095-24101(1998) The SOCS box of SOCS-1 accelerates ubiquitin-dependent proteolysis of TEL-JAK2.Kamizono S., Hanada T., Yasukawa H., Minoguchi S., Kato R., Minoguchi M., Hattori K., Hatakeyama S., Yada M., Morita S., Kitamura T., Kato H., Nakayama K.I., Yoshimura A.J. Biol. Chem. 276:12530-12538(2001) Socs-1 inhibits TEL-JAK2-mediated transformation of hematopoietic cells through inhibition of JAK2 kinase activity and induction of proteasome-mediated degradation.Frantsve J., Schwaller J., Sternberg D.W., Kutok J., Gilliland D.G.Mol. Cell. Biol. 21:3547-3557(2001) SOCS proteins negative regulators of cytokine signaling.Krebs D.L., Hilton D.J.Stem Cells 19:378-387(2001) Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin.Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.Biochem. Biophys. Res. Commun. 299:793-800(2002) Cytokine signaling in the brain putting a SOCS in it?Wang J., Campbell I.L.J. Neurosci. Res. 67:423-427(2002) Suppressors of cytokine signaling (SOCS) 1 and SOCS3 interact with and modulate fibroblast growth factor receptor signaling.Ben-Zvi T., Yayon A., Gertler A., Monsonego-Ornan E.J. Cell Sci. 119:380-387(2006)

4507233

NP_003736.1

NP_003736.1

O15524

27.6kD

Activated TLR4 Signalling Pathway (1269236); Adaptive Immune System Pathway (1269171); Adipogenesis Pathway (198832); Antigen Processing: Ubiquitination Proteasome Degradation Pathway (1269193); Class I MHC Mediated Antigen Processing Presentation Pathway (1269192); Cytokine Signaling In Immune System Pathway (1269310); ECS Complex Pathway (413455); ECS Complex Pathway (468394); EGFR1 Signaling Pathway (198782); EPO Receptor Signaling Pathway (198882)

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including IL2, IL3 erythropoietin (EPO), CSF2/GM-CSF, and interferon (IFN)-gamma. The protein encoded by this gene functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. [provided by RefSeq, Jul 2008]

SOCS1: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein- tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway. Interacts with multiple activated signaling proteins of the tyrosine kinase signaling pathway including JAK family kinases, TEC, KIT, GRB2 and VAV. Binding to JAKs is mediated through the KIR and SH2 domains to a phosphorylated tyrosine residue within the JAK JH1 domain. Binds the SH3 domain of GRB2 via diproline determinants in the N-terminus, and the N-terminal regulatory domain of VAV. Interacts with the Elongin BC complex (TCEB1 and TCEB2). Component of an ECS CBC(SOCS1) E3 ubiquitin-protein ligase complex which contains Elongin BC, CUL5, RBX1 and SOCS1. Interacts (via SH2 domain and SOCS box) with TRIM8. Interacts with AXL, CUL2 and FGFR3. Interacts with INSR. By a subset of cytokines including those belonging to the interferon, interleukin and colony-stimulating factor families. Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes. Protein type: Inhibitor. Chromosomal Location of Human Ortholog: 16p13.13. Cellular Component: cytoplasm; cytoplasmic membrane-bound vesicle; cytosol; nucleus. Molecular Function: insulin-like growth factor receptor binding; kinase inhibitor activity; protein binding; protein kinase binding; protein kinase inhibitor activity. Biological Process: cytokine and chemokine mediated signaling pathway; fat cell differentiation; JAK-STAT cascade; negative regulation of insulin receptor signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of tyrosine phosphorylation of Stat3 protein; organ regeneration; protein ubiquitination; regulation of cytokine secretion; regulation of growth; regulation of protein amino acid phosphorylation; regulation of tyrosine phosphorylation of Stat1 protein; response to drug; response to estradiol stimulus; response to lipopolysaccharide; response to progesterone stimulus

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

260

0.2 mg (E-Coli)

490

0.2 mg (Yeast)

600

0.5 mg (E-Coli)

715