product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 18 Protein E6
catalog :
MBS1226909
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1226909
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 18 Protein E6
products short name :
papillomavirus type 18 Protein E6
other names :
E6 protein; Protein E6; E6 protein
products gene name :
E6
other gene names :
E6; E6
uniprot entry name :
VE6_HPV18
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-158
sequence length :
158
sequence :
MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVL
ELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIREL
RHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEK
LRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRET
QV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
Transcriptional transactivator. Binds double-stranded DNA. Has transforming activity. Inactivates, with E6-AP ubiquitin-protein ligase, the human p53/TP53 tumor suppressor protein by targeting it to degradation. Binds and targets human MUPP1/MPDZ protein to degradation. Those two functions presumably contribute to transforming activity. Interaction with human FBLN1 protein also ses to be linked to cell transformation.
products references :
Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products.Cole S.T., Danos O.J. Mol. Biol. 193:599-608(1987) The expression of human papillomavirus type 18 E6 protein in bacteria and the production of anti-E6 antibodies.Matlashewski G., Banks L., Wu-Liao J., Spence P., Pim D., Crawford L.J. Gen. Virol. 67:1909-1916(1986) Nucleotide sequences of cDNAs for human papillomavirus type 18 transcripts in HeLa cells.Inagaki Y., Tsunokawa Y., Takebe N., Nawa H., Nakanishi S., Terada M., Sugimura T.J. Virol. 62:1640-1646(1988) Different human cervical carcinoma cell lines show similar transcription patterns of human papillomavirus type 18 early genes.Schneider-Gaedicke A., Schwarz E.EMBO J. 5:2285-2292(1986) Identification of early proteins of the human papilloma viruses type 16 (HPV 16)and type 18 (HPV 18)in cervical carcinoma cells.Seedorf K., Oltersdorf T., Kraemer G., Roewekamp W.EMBO J. 6:139-144(1987) E6 protein of human papillomavirus type 18 binds zinc.Grossman S.R., Laimins L.A.Oncogene 4:1089-1093(1989) The HPV-16 E6 and E6-AP complex functions as a ubiquitin-protein ligase in the ubiquitination of p53.Scheffner M., Huibregtse J.M., Vierstra R.D., Howley P.M.Cell 75:495-505(1993) Multi-PDZ domain protein MUPP1 is a cellular target for both adenovirus E4-ORF1 and high-risk papillomavirus type 18 E6 oncoproteins.Lee S.S., Glaunsinger B., Mantovani F., Banks L., Javier R.T.J. Virol. 74:9680-9693(2000) Interaction of oncogenic papillomavirus E6 proteins with fibulin-1.Du M., Fan X., Hong E., Chen J.J.Biochem. Biophys. Res. Commun. 296:962-969(2002) Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation.Thomas M., Laura R., Hepner K., Guccione E., Sawyers C., Lasky L., Banks L.Oncogene 21:5088-5096(2002) Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31.Lee C., Laimins L.A.J. Virol. 78:12366-12377(2004) HPV E6 specifically targets different cellular pools of its PDZ domain-containing tumour suppressor substrates for proteasome-mediated degradation.Massimi P., Gammoh N., Thomas M., Banks L.Oncogene 23:8033-8039(2004)
ncbi gi num :
9626070
ncbi acc num :
NP_040310.1
ncbi gb acc num :
NC_001357.1
uniprot acc num :
P06463
ncbi mol weight :
34.9kD
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!