product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
catalog :
MBS1224898
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1224898
products type :
Recombinant Protein
products full name :
Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
products short name :
Sulfide:quinone oxidoreductase
products name syn :
Cadmium resistance protein 1; Heavy metal tolerance protein 2
other names :
sulfide-quinone oxidoreductase; Sulfide:quinone oxidoreductase, mitochondrial; sulfide-quinone oxidoreductase; Cadmium resistance protein 1; Heavy metal tolerance protein 2
products gene name :
hmt2
other gene names :
hmt2; hmt2; cad1; cad1
uniprot entry name :
HMT2_SCHPO
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-459
sequence length :
459
sequence :
ASTHHKVLVVGGGSAGISVAHQIYNKFSKYRFANDQGKD
TSLKPGEIGIVDGAKYHYYQPGWTLTGAGLSSVAKTRRE
LASLVPADKFKLHPEFVKSLHPRENKIVTQSGQEISYDY
LVMAAGIYTDFGRIKGLTEALDDPNTPVVTIYSEKYADA
VYPWIEKTKSGNAIFTQPSGVLKCAGAPQKIMWMAEDYW
RRHKVRSNIDVSFYTGMPTLFSVKRYSDALLRQNEQLHR
NVKINYKDELVEVKGSERKAV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.
products references :
A fission yeast gene for mitochondrial sulfide oxidation.Vande Weghe J.G., Ow D.W.J. Biol. Chem. 274:13250-13257(1999) Molecular cloning of the gene involved in cadmium sensitivity of fission yeast Schizosaccaromyces pombe.Mutoh N., Kawabata M., Nakagawa C., Yamada K.The genome sequence of Schizosaccharomyces pombe.Wood V., Gwilliam R., Rajandream M.A., Lyne M.H., Lyne R., Stewart A., Sgouros J.G., Peat N., Hayles J., Baker S.G., Basham D., Bowman S., Brooks K., Brown D., Brown S., Chillingworth T., Churcher C.M., Collins M., Connor R., Cronin A., Davis P., Feltwell T., Fraser A., Gentles S., Goble A., Hamlin N., Harris D.E., Hidalgo J., Hodgson G., Holroyd S., Hornsby T., Howarth S., Huckle E.J., Hunt S., Jagels K., James K.D., Jones L., Jones M., Leather S., McDonald S., McLean J., Mooney P., Moule S., Mungall K.L., Murphy L.D., Niblett D., Odell C., Oliver K., O'Neil S., Pearson D., Quail M.A., Rabbinowitsch E., Rutherford K.M., Rutter S., Saunders D., Seeger K., Sharp S., Skelton J., Simmonds M.N., Squares R., Squares S., Stevens K., Taylor K., Taylor R.G., Tivey A., Walsh S.V., Warren T., Whitehead S., Woodward J.R., Volckaert G., Aert R., Robben J., Grymonprez B., Weltjens I., Vanstreels E., Rieger M., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Duesterhoeft A., Fritzc C., Holzer E., Moestl D., Hilbert H., Borzym K., Langer I., Beck A., Lehrach H., Reinhardt R., Pohl T.M., Eger P., Zimmermann W., Wedler H., Wambutt R., Purnelle B., Goffeau A., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Aves S.J., Xiang Z., Hunt C., Moore K., Hurst S.M., Lucas M., Rochet M., Gaillardin C., Tallada V.A., Garzon A., Thode G., Daga R.R., Cruzado L., Jimenez J., Sanchez M., del Rey F., Benito J., Dominguez A., Revuelta J.L., Moreno S., Armstrong J., Forsburg S.L., Cerutti L., Lowe T., McCombie W.R., Paulsen I., Potashkin J., Shpakovski G.V., Ussery D., Barrell B.G., Nurse P.Nature 415:871-880(2002)
ncbi gi num :
19112859
ncbi acc num :
NP_596067.1
ncbi gb acc num :
NM_001021978.2
uniprot acc num :
O94284
ncbi mol weight :
64.97kD
ncbi pathways :
Sulfur Metabolism Pathway (7672); Sulfur Metabolism Pathway (417)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!