GSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPP
GQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYM
DTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVP
LAIMSEAIAKVVLENKHKSSE

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondr ...
- Recombinant Human Cyclin-T1 (CCNT1) | MBS1225669
- Recombinant Immunogenic protein MPB70 (mpb70) | MBS1227599
- Recombinant Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) ...
- Recombinant Escherichia coli CS6 fimbrial subunit B | MBS1229388