product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Staphylococcus aureus Exfoliative toxin A
catalog :
MBS1223672
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1223672
products type :
Recombinant Protein
products full name :
Recombinant Staphylococcus aureus Exfoliative toxin A
products short name :
Exfoliative toxin A
products name syn :
Epidermolytic toxin A
other names :
exfoliative toxin A; Exfoliative toxin A; Epidermolytic toxin A
products gene name :
eta
other gene names :
eta
uniprot entry name :
ETA_STAAU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
39-280; Mature full length protein
sequence length :
280
sequence :
FNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
EVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQ
KYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFAN
GDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGA
GVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKL
ELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNS
GSGI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Has serine protease-like properties and binds to the skin protein profilaggrin. Cleaves substrates after acidic residues. Exfoliative toxins cause impetigous diseases commonly referred as staphylococcal scalded skin syndrome (SSSS).
products references :
Sequence determination and comparison of the exfoliative toxin A and toxin B genes from Staphylococcus aureus.Lee C.Y., Schmidt J.J., Johnson-Winegar A.D., Spero L., Iandolo J.J.J. Bacteriol. 169:3904-3909(1987) Nucleotide sequence of the epidermolytic toxin A gene of Staphylococcus aureus.O'Toole P.W., Foster T.J.J. Bacteriol. 169:3910-3915(1987) DNA sequencing of the eta gene coding for staphylococcal exfoliative toxin serotype A.Sakurai S., Suzuki H., Kondo I.J. Gen. Microbiol. 134:711-717(1988) The reactive serine residue of epidermolytic toxin A.Bailey C.J., Smith T.P.Biochem. J. 269:535-537(1990) The epidermolytic toxins are serine proteases.Dancer S.J., Garrat R., Saldanha J., Jhoti H., Evans R.FEBS Lett. 268:129-132(1990) The role of the serine protease active site in the mode of action of epidermolytic toxin of Staphylococcus aureus.Redpath M.B., Foster T.J., Bailey C.J.FEMS Microbiol. Lett. 65:151-155(1991) The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.Vath G.M., Earhart C.A., Rago J.V., Kim M.H., Bohach G.A., Schlievert P.M., Ohlendorf D.H.Biochemistry 36:1559-1566(1997) The structure of Staphylococcus aureus epidermolytic toxin A, an atypic serine protease, at 1.7-A resolution.Cavarelli J., Prevost G., Bourguet W., Moulinier L., Chevrier B., Delagoutte B., Bilwes A., Mourey L., Rifai S., Piemont Y., Moras D.Structure 5:813-824(1997)
ncbi gi num :
446988525
ncbi acc num :
WP_001065781.1
ncbi gb acc num :
WP_001065781.1
uniprot acc num :
P09331
ncbi mol weight :
31kD
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!