product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Immunoglobulin superfamily member 2 (Cd101) , partial
catalog :
MBS1223470
quantity :
0.01 mg (Baculovirus)
price :
255 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1223470
products type :
Recombinant Protein
products full name :
Recombinant Mouse Immunoglobulin superfamily member 2 (Cd101) , partial
products short name :
[Immunoglobulin superfamily member 2 (Cd101)]
other names :
[immunoglobulin superfamily member 2; Immunoglobulin superfamily member 2; immunoglobulin superfamily member 2; CD101 antigen; Glu-Trp-Ile EWI motif-containing protein 101; EWI-101; CD_antigen: CD101]
products gene name :
[Cd101]
other gene names :
[Cd101; Cd101; Gm734; Igsf2; Gm1016; EWI-101; Igsf2; IgSF2; EWI-101]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[22-266aa; Partial]
sequence length :
266
sequence :
REVKIQEGPLYRAEGYPVSIRCTVSGHQGPSTQDFRWSI
YLPSAPTKEVQIISTKDAGFSYAVYAQRVQSKEIYIERL
QGDSVLLHISKLQMKDAGEYECHTPNTDGKYFGSYSAKT
NLTVVPDTLSATMPSQTLSKKEGEPLELTCETTKATVQH
THLSLTWYLMQEGGGSQATEIVSLSKDFVLTPGSSYADR
FVAGDVRLDKLGATSFRLSVGKLQPSDQGQVFCEATEWI
QDPDETWTLIT
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mouse
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Baculovirus host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirushost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
268835535
ncbi acc num :
NP_001161378.1
ncbi gb acc num :
NM_001167906.1
uniprot acc num :
A8E0Y8
ncbi mol weight :
114,205 Da
uniprot summary :
Plays a role as inhibitor of T-cells proliferation induced by CD3. Inhibits expression of IL2RA on activated T-cells and secretion of IL2. Inhibits tyrosine kinases that are required for IL2 production and cellular proliferation. Inhibits phospholipase C-gamma-1/PLCG1 phosphorylation and subsequent CD3-induced changes in intracellular free calcium. Prevents nuclear translocation of nuclear factor of activated T-cell to the nucleus. Plays a role in the inhibition of T-cell proliferation via IL10 secretion by cutaneous dendritic cells ().
size1 :
0.01 mg (Baculovirus)
price1 :
255 USD
size2 :
0.02 mg (Baculovirus)
price2 :
395
size3 :
0.05 mg (Baculovirus)
price3 :
755
size4 :
0.1 mg (Baculovirus)
price4 :
1040
size5 :
0.5 mg (Baculovirus)
price5 :
1480
size6 :
1 mg (Baculovirus)
price6 :
2060
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!