Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (Cyp27b1), partial | MyBioSource MBS1219313 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (Cyp27b1), partial

catalog :

MBS1219313

quantity :

0.01 mg (E-Coli)

price :

235 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1219313

products type :

Recombinant Protein

products full name :

Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (Cyp27b1), partial

products short name :

[25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (Cyp27b1), partial]

products name syn :

[25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; EC=1.14.13.13; 25-OHD-1 alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; VD3 1A hydroxylase; Calcidiol 1-monooxygenase; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1]

other names :

[25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; P450VD1alpha; 1alpha(OH)ase; VD3 1A hydroxylase; cytochrome p450 27B1; cytochrome P450, 27b1; cytochrome P450C1 alpha; cytochrome P450VD1-alpha; calcidiol 1-monooxygenase; 25(OH)D 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); cytochrome P450, family 27, subfamily b, polypeptide 1; 25-OHD-1 alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; VD3 1A hydroxylase; Calcidiol 1-monooxygenase; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; Cytochrome p450 27B1]

products gene name :

[Cyp27b1]

products gene name syn :

[Cyp27b1; Cyp27b; Cyp40]

other gene names :

[Cyp27b1; Cyp27b1; Vdr; Cp2b; Cyp1; Pddr; Vdd1; Vddr; Cyp40; VddrI; Cyp27b; P450c1; Cyp27b; Cyp40; VD3 1A hydroxylase]

uniprot entry name :

CP27B_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[1-507. full length protein.]

sequence length :

507

sequence :

MTQAVKLASRVFHRIHLPLQLDASLGSRGSESVLRSLSD
IPGPSTLSFLAELFCKGGLSRLHELQVHGAARYGPIWSG
SFGTLRTVYVADPTLVEQLLRQESHCPERCSFSSWAEHR
RRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAAAGYAG
TLDNVVRDLVRRLRRQRGRGSGLPGLVLDVAGEFYKFGL
ESIGAVLLGSRLGCLEAEVPPDTETFIHAVGSVFVSTLL
TMAMPNWLHHLIPGPWARLCRDWDQMFAFAQRHVELREG
EAAMRNQGKPEEDMPSGHHLTHFLFREKVSVQSIVGNVT
ELLLAGVDTVSNTLSWTLYELSRHPDVQTALHSEITAGT
RGSCAHPHGTALSQLPLLKAVIKEVLRLYPVVPGNSRVP
DRDIRVGNYVIPQDTLVSLCHYATSRDPTQFPDPNSFNP
ARWLGEGPTPHPFASLPFGFGKRSCIGRRLAELELQMAL
SQILTHFEVLPEPGALPIKPMTRTVLVPERSINLQFVDR

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-PAGE

other info1 :

Species: Mus musculus (Mouse)

products description :

Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D3) to 1-alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3), and of 24,25-dihydroxyvitamin D3 (24,25(OH)2D3) to 1-alpha,24,25-trihydroxyvitamin D3 (1alpha,24,25(OH)3D3). Is also active with 25-hydroxy-24-oxo-vitamin D3. Plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.

ncbi gi num :

227497562

ncbi acc num :

NP_034139.2

ncbi gb acc num :

NM_010009.2

uniprot acc num :

O35084

ncbi mol weight :

56,225 Da

ncbi pathways :

1,25-dihydroxyvitamin D3 Biosynthesis Pathway (542888); Biological Oxidations Pathway (970688); Cholecalciferol Biosynthesis Pathway (421791); Cholecalciferol Biosynthesis Pathway (468294); Cytochrome P450 Pathway (198390); Cytochrome P450 - Arranged By Substrate Type Pathway (971395); Metabolic Pathways (132962); Metabolism Pathway (971233); Metabolism Of Lipids And Lipoproteins Pathway (970615); Metabolism Of Steroid Hormones And Vitamin D Pathway (1001061)

uniprot summary :

CYP27B1: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. Defects in CYP27B1 are the cause of rickets vitamin D- dependent type 1A (VDDR1A); also known as pseudovitamin D deficiency rickets (PDDR). A disorder caused by a selective deficiency of the active form of vitamin D (1,25- dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. Belongs to the cytochrome P450 family. Protein type: Lipid Metabolism - steroid biosynthesis; Mitochondrial; Oxidoreductase; EC 1.14.13.13; Cell cycle regulation. Cellular Component: membrane; mitochondrion; cytoplasm. Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; metal ion binding; iron ion binding; heme binding; calcidiol 1-monooxygenase activity; oxidoreductase activity; monooxygenase activity. Biological Process: response to drug; response to cAMP; response to lipopolysaccharide; vitamin D metabolic process; response to insulin stimulus; calcium ion homeostasis; negative regulation of cell proliferation; response to vitamin D; response to copper ion; calcium ion transport; negative regulation of cell growth; regulation of bone mineralization; aging; positive regulation of keratinocyte differentiation; vitamin D catabolic process

size1 :

0.01 mg (E-Coli)

price1 :

235 USD

size2 :

0.05 mg (E-Coli)

price2 :

320

size3 :

0.1 mg (E-Coli)

price3 :

535

size4 :

0.2 mg (E-Coli)

price4 :

855

size5 :

0.5 mg (E-Coli)

price5 :

1125

size6 :

1 mg (E-Coli)

price6 :

1725

more info or order :

MyBioSource product webpage