catalog number :
MBS1218993
products type :
Recombinant Protein
products full name :
Recombinant Mouse Branched-chain-amino-acid aminotransferase, mitochondrial (Bcat2)
products short name :
[Branched-chain-amino-acid aminotransferase, mitochondrial (Bcat2)]
other names :
[branched-chain-amino-acid aminotransferase, mitochondrial isoform 1; Branched-chain-amino-acid aminotransferase, mitochondrial; branched-chain-amino-acid aminotransferase, mitochondrial; branched chain aminotransferase 2, mitochondrial]
products gene name :
[Bcat2]
other gene names :
[Bcat2; Bcat2; Eca40; Bcat-2; Bcat(m); Bcatm; Eca40; BCAT(m)]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[28-393. Full Length of Mature Protein]
sequence :
VSSIFKAADLQIQMTKEPQKKPAPSQALLFGKTFTDHML
MVEWNNKAGWGPPRIQPFQNLTLHPACSGLHYSLQLFEG
LKAYKGGDQQVRLFRPWLNMDRMLRSARRLCLPDFDKQE
LLECIRQLIEVDKDWVPDGNGTSLYVRPVLIGNEPSLGV
GMVTQALLYVILCPVGSYFPGDSMTPVSLLADPSFVRAW
IGGVGDCKLGGNYGPTVAVQREAQKRGCEQVLWLYGPDH
QLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQ
SLLDLARTWGEFRVAERKVTMKELKRALEEGRVREVFGS
GTACQVCPVHQILYEGKQLHIPTMENGPELILRFQKELK
AIQYGASAHDWMFRV
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Mouse
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene.
ncbi acc num :
NP_033867.1
ncbi gb acc num :
NM_009737.3
ncbi mol weight :
44,127 Da
ncbi pathways :
2-Oxocarboxylic Acid Metabolism Pathway (715633); 2-Oxocarboxylic Acid Metabolism Pathway (717400); Biosynthesis Of Amino Acids Pathway (790952); Biosynthesis Of Amino Acids Pathway (795174); Biosynthesis Of Antibiotics Pathway (1145933); Branched-chain Amino Acid Catabolism Pathway (1254465); Leucine Catabolism Pathway (542845); Leucine Degradation, Leucine = Acetoacetate + Acetyl-CoA Pathway (421754); Leucine Degradation, Leucine = Acetoacetate + Acetyl-CoA Pathway (468229); Metabolic Pathways (132962)
uniprot summary :
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
size6 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)