Recombinant Human Chromobox protein homolog 7 | MyBioSource MBS1218451 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Chromobox protein homolog 7

catalog :

MBS1218451

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1218451

products type :

Recombinant Protein

products full name :

Recombinant Human Chromobox protein homolog 7

products short name :

Chromobox protein homolog 7

other names :

chromobox protein homolog 7; Chromobox protein homolog 7; chromobox protein homolog 7; chromobox 7

products gene name :

CBX7

other gene names :

CBX7; CBX7

uniprot entry name :

CBX7_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-251

sequence length :

251

sequence :

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKY
STWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKR
LLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGV
VKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKF
PPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQP
PEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTF
REAQAAEGFFRDRSGKF

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.

products references :

The DNA sequence of human chromosome 22.Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.Nature 402:489-495(1999) Polycomb CBX7 has a unifying role in cellular lifespan.Gil J., Bernard D., Martinez D., Beach D.Nat. Cell Biol. 6:67-72(2004) Ring1B contains a ubiquitin-like docking module for interaction with Cbx proteins.Bezsonova I., Walker J.R., Bacik J.P., Duan S., Dhe-Paganon S., Arrowsmith C.H.Biochemistry 48:10542-10548(2009) Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.Maertens G.N., El Messaoudi-Aubert S., Racek T., Stock J.K., Nicholls J., Rodriguez-Niedenfuhr M., Gil J., Peters G.PLoS ONE 4:E6380-E6380(2009) Polycomb CBX7 directly controls trimethylation of histone H3 at lysine 9 at the p16 locus.Li Q., Wang X., Lu Z., Zhang B., Guan Z., Liu Z., Zhong Q., Gu L., Zhou J., Zhu B., Ji J., Deng D.PLoS ONE 5:E13732-E13732(2010) Interaction proteomics analysis of polycomb proteins defines distinct PRC1 Complexes in mammalian cells.Vandamme J., Volkel P., Rosnoblet C., Le Faou P., Angrand P.O.Mol. Cell. Proteomics 0:0-0(2011) Solution NMR structure of the chromobox protein homolog 7.Structural genomics consortium (SGC) Submitted (MAR-2008) to the PDB data bankPolycomb group targeting through different binding partners of RING1B C-terminal domain.Wang R., Taylor A.B., Leal B.Z., Chadwell L.V., Ilangovan U., Robinson A.K., Schirf V., Hart P.J., Lafer E.M., Demeler B., Hinck A.P., McEwen D.G., Kim C.A.Structure 18:966-975(2010) Recognition and specificity determinants of the human cbx chromodomains.Kaustov L., Ouyang H., Amaya M., Lemak A., Nady N., Duan S., Wasney G.A., Li Z., Vedadi M., Schapira M., Min J., Arrowsmith C.H.J. Biol. Chem. 286:521-529(2011)

ncbi gi num :

28372505

ncbi acc num :

NP_783640.1

ncbi gb acc num :

NM_175709.3

uniprot acc num :

O95931

ncbi mol weight :

32.4kD

uniprot summary :

CBX7: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity. Protein type: Transcription regulation. Chromosomal Location of Human Ortholog: 22q13.1. Cellular Component: cytoplasm; heterochromatin; nuclear chromatin; nucleoplasm; nucleus; PcG protein complex. Molecular Function: chromatin binding; methylated histone residue binding; protein binding; single-stranded RNA binding. Biological Process: chromatin modification; negative regulation of transcription from RNA polymerase II promoter; response to drug; sebaceous gland development; transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage