product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)
catalog :
MBS1218119
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1218119 image 1
product information
catalog number :
MBS1218119
products type :
Recombinant Protein
products full name :
Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)
products short name :
[Tail virion protein G9P (IX)]
products name syn :
[Recombinant Tail virion protein G9P (IX); Tail virion protein G9P; Coat protein C, polypeptIDe II G9P]
other names :
[structural protein; minor coat protein]
products gene name syn :
[IX]
other gene names :
[IX]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-32aa; Full Length]
sequence length :
32
sequence :
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
image1 heading :
SDS-PAGE
other info1 :
Species: Enterobacteria phage M13 (Bacteriophage M13)
products categories :
Microbiology
products description :
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
ncbi gi num :
17426222
ncbi acc num :
NP_510889.1
ncbi gb acc num :
NC_003287.2
uniprot acc num :
P03677
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!