Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial | MyBioSource MBS1217912 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial

catalog :

MBS1217912

quantity :

0.01 mg (E-Coli)

price :

235 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1217912

products type :

Recombinant Protein

products full name :

Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial

products short name :

[HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A)]

other names :

[HLA class I histocompatibility antigen, A-1 alpha chain A*01:01:01:01; HLA class I histocompatibility antigen, A-1 alpha chain; HLA class I histocompatibility antigen, A-1 alpha chain; major histocompatibility complex, class I, A; MHC class I antigen A*1]

products gene name :

[HLA-A]

other gene names :

[HLA-A; HLA-A; HLAA; HLAA]

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[25-308aa; Extracellular Domain]

sequence :

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSD
AASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANL
GTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDA
YDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPIS
DHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETR
PAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLR
WELSSQPTIPI

purity :

>85% (SDS-PAGE)

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-Page

other info1 :

Species: Homo sapiens (Human)

other info2 :

Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

ncbi gi num :

337752170

ncbi acc num :

NP_001229687.1

ncbi gb acc num :

NM_001242758.1

uniprot acc num :

P30443

ncbi mol weight :

40,846 Da

ncbi pathways :

Adaptive Immune System Pathway (366160); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway (366163); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); Antigen Processing-Cross Presentation Pathway (477122); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Cell Adhesion Molecules (CAMs) Pathway (83069)

ncbi summary :

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]

uniprot summary :

Involved in the presentation of foreign antigens to the immune system.

size1 :

0.01 mg (E-Coli)

price1 :

235 USD

size2 :

0.05 mg (E-Coli)

price2 :

320

size3 :

0.1 mg (E-Coli)

price3 :

535

size4 :

0.2 mg (E-Coli)

price4 :

855

size5 :

0.5 mg (E-Coli)

price5 :

1125

size6 :

1 mg (E-Coli)

price6 :

1725

more info or order :

MyBioSource product webpage