Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial | MyBioSource MBS1214914 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

catalog :

MBS1214914

quantity :

1 mg (E-Coli)

price :

1375 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1214914

products type :

Recombinant Protein

products full name :

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

products short name :

Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

products name syn :

Recombinant Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial; Transient receptor potential cation channel subfamily A member 1; Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120

other names :

transient receptor potential cation channel subfamily A member 1; Transient receptor potential cation channel subfamily A member 1; transient receptor potential cation channel subfamily A member 1; transformation-sensitive protein p120; ankyrin-like with transmembrane domains 1; ankyrin-like with transmembrane domains protein 1; transient receptor potential cation channel, subfamily A, member 1; Ankyrin-like with transmembrane domains protein 1; Transformation-sensitive protein p120

products gene name syn :

TRPA1; ANKTM1

other gene names :

TRPA1; TRPA1; ANKTM1; ANKTM1

uniprot entry name :

TRPA1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

957-1119

sequence :

IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFL
RKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIP
NADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKME
IISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKA
KTHHLEP

purity :

>90%(SDS-PAGE)

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

other info1 :

Species: Homo sapiens (Human)

products description :

Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function . Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes . Is also activated by menthol (in vitro). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana . May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).

ncbi gi num :

116534990

ncbi acc num :

NP_015628.2

ncbi gb acc num :

NM_007332.2

uniprot acc num :

O75762

ncbi mol weight :

19kD

ncbi summary :

The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq, Jul 2008]

uniprot summary :

TRPA1: Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)- tetrahydrocannabinol (THC), the psychoactive component of marijuana. Not involved in menthol sensation. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system. Belongs to the transient receptor (TC 1.A.4) family. Protein type: Membrane protein, integral; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 8q13. Cellular Component: stereocilium bundle; integral to plasma membrane; plasma membrane. Molecular Function: channel activity; calcium channel activity. Biological Process: response to drug; detection of chemical stimulus involved in sensory perception of pain; detection of mechanical stimulus involved in sensory perception of pain; response to hydrogen peroxide; response to pain; ion transport; response to cold; thermoception; transmembrane transport. Disease: Episodic Pain Syndrome, Familial, 1

size1 :

1 mg (E-Coli)

price1 :

1375 USD

size2 :

1 mg (Yeast)

price2 :

1835

more info or order :

MyBioSource product webpage