catalog number :
MBS1214011
products type :
Recombinant Protein
products full name :
Recombinant Mouse Ceramide glucosyltransferase (Ugcg)
products short name :
Ceramide glucosyltransferase (Ugcg)
products name syn :
Recombinant Ceramide glucosyltransferase (Ugcg); Ceramide glucosyltransferase EC= 2.4.1.80; GLCT-1 Glucosylceramide synthase; GCS UDP-glucose ceramide glucosyltransferase UDP-glucose:N-acylsphingosine D-glucosyltransferase
other names :
ceramide glucosyltransferase; Ceramide glucosyltransferase; ceramide glucosyltransferase; GCS; glucosylceramide synthase; UDP-glucose:N-acylsphingosine D-glucosyltransferase; ectoplacental cone, invasive trophoblast giant cells, extraembryonic ectoderm and chorion sequence 21; UDP-glucose ceramide glucosyltransferase; GLCT-1; Glucosylceramide synthase; GCS; UDP-glucose ceramide glucosyltransferase; UDP-glucose:N-acylsphingosine D-glucosyltransferase
products gene name syn :
Ugcg
other gene names :
Ugcg; Ugcg; Ugcgl; C80537; Epcs21; GlcT-1; AU043821; GCS
uniprot entry name :
CEGT_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
33-195aa, Partial. Provide the complete intracellular domain
sequence :
TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLE
TFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDA
RLFIGGKKVGINPKINNLMPAYEVAKYDLIWICDSGIRV
IPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVY
FGTSHPR
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Mus musculus (Mouse)
products description :
Catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. May also serve as a "flippase" (By similarity).
ncbi acc num :
NP_035803.1
ncbi gb acc num :
NM_011673.3
ncbi pathways :
Lactosylceramide Biosynthesis Pathway (421767); Lactosylceramide Biosynthesis Pathway (468259); Sphingolipid Metabolism Pathway (83193); Sphingolipid Metabolism Pathway (369); Sphingolipids Metabolism Pathway (522984)
uniprot summary :
UGCG: Catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. May also serve as a flippase. Belongs to the glycosyltransferase 2 family. Protein type: Lipid Metabolism - sphingolipid; Membrane protein, integral; Transferase; EC 2.4.1.80; Membrane protein, multi-pass. Cellular Component: Golgi apparatus; membrane; integral to membrane. Molecular Function: transferase activity; ceramide glucosyltransferase activity; transferase activity, transferring glycosyl groups. Biological Process: sphingolipid metabolic process; glucosylceramide biosynthetic process; lipid metabolic process
size2 :
0.05 mg (Baculovirus)
size3 :
0.05 mg (Mammalian-Cell)