Recombinant Human Toll-like receptor 2 | MyBioSource MBS1213928 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Toll-like receptor 2

catalog :

MBS1213928

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1213928

products type :

Recombinant Protein

products full name :

Recombinant Human Toll-like receptor 2

products short name :

Toll-like receptor 2

products name syn :

Toll/interleukin-1 receptor-like protein 4; CD282

other names :

toll-like receptor 2; Toll-like receptor 2; toll-like receptor 2; toll like receptor 2; Toll/interleukin-1 receptor-like protein 4; CD_antigen: CD282

products gene name :

TLR2

other gene names :

TLR2; TLR2; TIL4; CD282; TIL4

uniprot entry name :

TLR2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

19-588

sequence length :

784

sequence :

KEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSL
DLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSF
SSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNP
YKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLT
FLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILL
LEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIK
KFTFRNVKITDESLFQVMKLL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B. burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6.

products references :

Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4 evidence for a multi-gene receptor family in humans.Chaudhary P.M., Ferguson C., Nguyen V., Nguyen O., Massa H.F., Eby M., Jasmin A., Trask B.J., Hood L., Nelson P.S.Blood 91:4020-4027(1998) A family of human receptors structurally related to Drosophila Toll.Rock F.L., Hardiman G., Timans J.C., Kastelein R.A., Bazan J.F.Proc. Natl. Acad. Sci. U.S.A. 95:588-593(1998) Toll-like receptor-2 mediates lipopolysaccharide-induced cellular signalling.Yang R.-B., Mark M.R., Gray A.M., Huang A., Xie M.-H., Zhang M., Goddard A.D., Wood W.I., Gurney A.L., Godowski P.J.Nature 395:284-288(1998) Natural selection in the TLR-related genes in the course of primate evolution.Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A.Immunogenetics 60:727-735(2008) The heterogeneous allelic repertoire of human Toll-Like receptor (TLR) genes.Georgel P., Macquin C., Bahram S.PLoS ONE 4:E7803-E7803(2009)

ncbi gi num :

19718734

ncbi acc num :

NP_003255.2

ncbi gb acc num :

NM_003264.4

uniprot acc num :

O60603

ncbi mol weight :

80.4kD

ncbi pathways :

Activated TLR4 Signalling Pathway (1269236); Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); Beta Defensins Pathway (1269267); Chagas Disease (American Trypanosomiasis) Pathway (147809); Chagas Disease (American Trypanosomiasis) Pathway (147795); Defensins Pathway (1269265); Disease Pathway (1268854); Diseases Associated With The TLR Signaling Cascade Pathway (1269157); Diseases Of Immune System Pathway (1269156)

ncbi summary :

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1370

more info or order :

MyBioSource product webpage