protein

Recombinant Mouse Regenerating islet-derived protein 3-gamma

MBS1213774

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Mouse Regenerating islet-derived protein 3-gamma

Regenerating islet-derived protein 3-gamma

Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma

regenerating islet-derived protein 3-gamma; Regenerating islet-derived protein 3-gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived 3 gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma

Reg3g

Reg3g; Reg3g; AI449515; Pap3; REG-3-gamma; Reg III-gamma

REG3G_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

27-174

174

EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDAD
MACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWI
GLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGN
HCGTLSRASGFLKWRENYCNLELPYVCKFKA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L. monocytogenes and methicillin-resistant S. aureus. Regulates keratinocyte proliferation and differentiation after skin injury

Structure, chromosomal localization and expression of mouse genes encoding type III Reg, RegIII alpha, RegIII beta, RegIII gamma.Narushima Y., Unno M., Nakagawara K., Mori M., Miyashita H., Suzuki Y., Noguchi N., Takasawa S., Kumagai T., Yonekura H., Okamoto H.Gene 185:159-168(1997) Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.Mukherjee S., Partch C.L., Lehotzky R.E., Whitham C.V., Chu H., Bevins C.L., Gardner K.H., Hooper L.V.J. Biol. Chem. 284:4881-4888(2009) Refolding, purification, and characterization of human and murine RegIII proteins expressed in Escherichia coli.Cash H.L., Whitham C.V., Hooper L.V.Protein Expr. Purif. 48:151-159(2006) Symbiotic bacteria direct expression of an intestinal bactericidal lectin.Cash H.L., Whitham C.V., Behrendt C.L., Hooper L.V.Science 313:1126-1130(2006) MyD88-mediated signals induce the bactericidal lectin RegIII gamma and protect mice against intestinal Listeria monocytogenes infection.Brandl K., Plitas G., Schnabl B., De;Matteo R.P., Pamer E.G.J. Exp. Med. 204:1891-1900(2007) The antibacterial lectin RegIIIgamma promotes the spatial segregation of microbiota and host in the intestine.Vaishnava S., Yamamoto M., Severson K.M., Ruhn K.A., Yu X., Koren O., Ley R., Wakeland E.K., Hooper L.V.Science 334:255-258(2011) The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury.Lai Y., Li D., Li C., Muehleisen B., Radek K.A., Park H.J., Jiang Z., Li Z., Lei H., Quan Y., Zhang T., Wu Y., Kotol P., Morizane S., Hata T.R., Iwatsuki K., Tang C., Gallo R.L.Immunity 37:74-84(2012) Innate Stat3-mediated induction of the antimicrobial protein Reg3gamma is required for host defense against MRSA pneumonia.Choi S.M., McAleer J.P., Zheng M., Pociask D.A., Kaplan M.H., Qin S., Reinhart T.A., Kolls J.K.J. Exp. Med. 210:551-561(2013)

6755310

NP_035390.1

NM_011260.1

O09049

20.4kD

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070