catalog number :
MBS1213669
products type :
Recombinant Protein
products full name :
Recombinant Human Elongation factor 2
products short name :
Elongation factor 2
other names :
elongation factor 2; Elongation factor 2; elongation factor 2; eukaryotic translation elongation factor 2
products gene name :
EEF2
products gene name syn :
EF2
other gene names :
EEF2; EEF2; EF2; EF-2; EEF-2; SCA26; EF2; EF-2
uniprot entry name :
EF2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-858, Full length
sequence :
VNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLV
CKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFY
ELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAA
LRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMM
NKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGE
SGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAK
FAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFS
KSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFKKEETA
KLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQ
MITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPK
GPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIM
GPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNI
VGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVA
VEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIA
GAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEE
SNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSAR
QELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILTD
ITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFD
VHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLME
PIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPM
FVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQIL
PGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movent of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
products references :
Complete sequence of the coding region of human elongation factor 2 (EF-2)
by enzymatic amplification of cDNA from human ovarian granulosa cells.Rapp G., Klaudiny J., Hagendorff G., Luck M.R., Heinz K.Biol. Chem. Hoppe-Seyler 370:1071-1075(1989)
Construction of a plasmid containing the complete coding region of human elongation factor 2.Hanes J., Freudenstein J., Rapp G., Scheit K.H.Biol. Chem. Hoppe-Seyler 373:201-204(1992)
Ustek D., Bektas M., Cakiris A., Oku B., Bermek E.
ncbi acc num :
NP_001952.1
ncbi gb acc num :
NM_001961.3
ncbi pathways :
AMPK Signaling Pathway (198868); AMPK Signaling Pathway (989139); AMPK Signaling Pathway (992181); BDNF Signaling Pathway (712093); Disease Pathway (1268854); Eukaryotic Translation Elongation Pathway (1268690); Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1268702); Gene Expression Pathway (1269649); Infectious Disease Pathway (1269056); Metabolism Of Proteins Pathway (1268677)
ncbi summary :
This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. [provided by RefSeq, Jul 2008]
uniprot summary :
EEF2: a member of the GTP-binding translation elongation factor family. An essential factor for protein synthesis. Promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by eEF2 kinase phosphorylation. eEF2 kinase is normally dependent on Ca2+ ions and calmodulin. eEF2 kinase can also be activated by PKA in response to elevated cAMP levels, which are generally increased in stress- or starvation-related conditions. A variety of treatments known to raise intracellular Ca2+ or cAMP levels have been shown to result in increased phosphorylation of eEF2, and thus to inhibit peptide-chain elongation. Protein type: Translation; Translation elongation. Chromosomal Location of Human Ortholog: 19p13.3. Cellular Component: cytoplasm; cytosol; lipid raft; membrane; nucleus; plasma membrane; polysomal ribosome; ribonucleoprotein complex. Molecular Function: 5S rRNA binding; actin filament binding; GTP binding; GTPase activity; p53 binding; protein binding; protein kinase binding; ribosome binding; translation elongation factor activity. Biological Process: aging; cellular protein metabolic process; gene expression; glial cell proliferation; hemopoietic progenitor cell differentiation; peptidyl-diphthamide biosynthetic process from peptidyl-histidine; positive regulation of translation; post-translational protein modification; response to estradiol stimulus; response to ethanol; response to fluoxetine; response to folic acid; response to hydrogen peroxide; skeletal muscle contraction; translation; translational elongation. Disease: Spinocerebellar Ataxia 26
size4 :
0.05 mg (Baculovirus)