
STALQVSLTRTQQAQTFMKRLNKFKGLKARQYAAIHDCL
EEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWV
SAALTDETTCMDGFAGKGMDGKIKESVRAQVVAVARVTS
NALALVNNFAAKHKH

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Escherichia coli DNA helicase II (uvrD) | MBS1216251
- Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A ...
- Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX) | MBS1218119
- Recombinant Mouse Branched-chain-amino-acid aminotransferase, mitochondrial (Bca ...
- Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (Cyp27b ...