protein

Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1

MBS1211336

0.01 mg (E-Coli)

135 USD

Recombinant Protein

Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1

DNA-directed RNA polymerase II subunit RPB1

DNA-directed RNA polymerase III largest subunit

RNA polymerase II 215kD subunit; DNA-directed RNA polymerase II subunit RPB1; CG1554 gene product from transcript CG1554-RA; RNA polymerase II 215kD subunit; DNA-directed RNA polymerase III largest subunit

RpII215

RpII215; RpII215; 5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmelCG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[s; RNA polymerase II subunit B1

RPB1_DROME

E Coli or Yeast or Baculovirus or Mammalian Cell

1579-1881

1887

YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRY
ASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPS
FAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPS
SPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNY
SASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPG
SPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYS
PTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTAR
NYSPTSPMYSPTAPSHYSPTSPAYSPSSPT

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Species: Drosophila melanogaster (Fruit fly)

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing

Analysis of the gene encoding the largest subunit of RNA polymerase II in Drosophila." Jokerst R.S., Weeks J.R., Zehring W.A., Greenleaf A.L. Mol. Gen. Genet. 215:266-275(1989)

17530899

NP_511124.1

NM_078569.3

P04052

33.56kD

DNA Repair Pathway (1328795); Dual Incision In TC-NER Pathway (1328836); Eukaryotic Transcription Initiation Pathway (198256); Formation Of RNA Pol II Elongation Complex Pathway (1329557); Formation Of TC-NER Pre-Incision Complex Pathway (1328835); Formation Of The Early Elongation Complex Pathway (1329556); Gap-filling DNA Repair Synthesis And Ligation In TC-NER Pathway (1328837); Gene Expression Pathway (1329531); Metabolic Pathways (132021); Nucleotide Excision Repair Pathway (1328828)

0.01 mg (E-Coli)

135 USD

0.05 mg (E-Coli)

255

0.2 mg (E-Coli)

665

0.05 mg (Baculovirus)

1060

0.5 mg (E-Coli)

1090