protein

Recombinant Epstein-Barr virus Latent membrane protein 2 (LMP2)

MBS1208762

1 mg (E-Coli)

2055 USD

Recombinant Protein

Recombinant Epstein-Barr virus Latent membrane protein 2 (LMP2)

Latent membrane protein 2 (LMP2)

Recombinant Latent membrane protein 2 (LMP2); Latent membrane protein 2; Terminal protein

K15; Latent membrane protein 2; K15; LMP-2A; Terminal protein

LMP2

LMP-2A; LMP2

LMP2_EBVB9

E Coli or Yeast or Baculovirus or Mammalian Cell

1-497

497

MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSG
NTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLG
TQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGR
GSMNPVCLPVIVAPYLFWLAAIAASCFTAS

>90%(SDS-PAGE)

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Species: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.Isoform LMP2B may be a negative regulator of isoform LMP2A.

82503189

YP_401631.1

NC_007605.1

P13285

32kD

Function: Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs. Ref.5 Ref.8Isoform LMP2B may be a negative regulator of isoform LMP2A. Ref.5 Ref.8. Subunit structure: Isoform LMP2A cytoplasmic N-terminal domain interacts with human SRC family protein tyrosine kinases SYK and LYN. Binds human ITCH, WWP2 and NEDD4L. Ref.6 Ref.9. Subcellular location: Isoform LMP2A: Host cell membrane; Multi-pass membrane protein. Note: Isoform LMP2A is localized in plasma membrane lipid rafts. Ref.10 Ref.11Isoform LMP2B: Host endomembrane system; Multi-pass membrane protein. Host cytoplasm host perinuclear region. Note: Isoform LMP2B localizes to perinuclear regions. Ref.10 Ref.11. Post-translational modification: Isoform LMP2A is phosphorylated on cytoplasmic N-terminal tyrosines residues, possibly by human LYN. Ref.4Can be ubiquitinated by human ITCH and WWP2 on the N-terminus in a lysine-independent manner. Miscellaneous: In healthy individuals, EBV typically establishes a persistent latent infection in which the virus can be detected in resting, nonproliferating peripheral B-lymphocytes. These latently infected cells express only 2 virally encoded genes, LMP2A and EBNA1. Sequence similarities: Belongs to the herpesviridae LMP-2 family.

1 mg (E-Coli)

2055 USD

1 mg (Yeast)

2515