product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Xenopus laevis Protein Wnt-8
catalog :
MBS1208564
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
citations: 1
Reference
Eroshkin F, Nesterenko A, Borodulin A, Martynova N, Ermakova G, Gyoeva F, et al. Noggin4 is a long-range inhibitor of Wnt8 signalling that regulates head development in Xenopus laevis. Sci Rep. 2016;6:23049 pubmed publisher
product information
catalog number :
MBS1208564
products type :
Recombinant Protein
products full name :
Recombinant Xenopus laevis Protein Wnt-8
products short name :
Protein Wnt-8
other names :
protein Wnt-8; Protein Wnt-8; protein Wnt-8; wingless-type MMTV integration site family member 8A
products gene name :
wnt8
other gene names :
wnt8a; wnt8; wnt8; Xwnt8; wnt-8; xwnt-8; XWnt-8
uniprot entry name :
WNT8_XENLA
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-358
sequence length :
358
sequence :
AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAW
ERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYT
LTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEF
GERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMK
RTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQAL
KLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDS
PDYCLKNISLGLQGTEGRECL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Ligand for mbers of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.
products references :
Xwnt-8, a Xenopus Wnt-1/int-1-related gene responsive to mesoderm-inducing growth factors, may play a role in ventral mesodermal patterning during embryogenesis.Christian J.L., McMahon J.A., McMahon A.P., Moon R.T.Development 111:1045-1055(1991) Xwnt-8b a maternally expressed Xenopus Wnt gene with a potential role in establishing the dorsoventral axis.Cui Y., Brown J.D., Moon R.T., Christian J.L.Development 121:2177-2186(1995) Isolation of cDNAs partially encoding four Xenopus Wnt-1/int-1-related proteins and characterization of their transient expression during embryonic development.Christian J.L., Gavin B.J., McMahon A.P., Moon R.T.Dev. Biol. 143:230-234(1991) Specification of mesodermal pattern in Xenopus laevis by interactions between Brachyury, noggin and Xwnt-8.Cunliffe V., Smith J.C.EMBO J. 13:349-359(1994) The head inducer Cerberus is a multifunctional antagonist of Nodal, BMP and Wnt signals.Piccolo S., Agius E., Leyns L., Bhattacharyya S., Grunz H., Bouwmeester T., De Robertis E.M.Nature 397:707-710(1999) Tiki1 is required for head formation via Wnt cleavage-oxidation and inactivation.Zhang X., Abreu J.G., Yokota C., Macdonald B.T., Singh S., Coburn K.L., Cheong S.M., Zhang M.M., Ye Q.Z., Hang H.C., Steen H., He X.Cell 149:1565-1577(2012) Structural basis of Wnt recognition by Frizzled.Janda C.Y., Waghray D., Levin A.M., Thomas C., Garcia K.C.Science 337:59-64(2012)
ncbi gi num :
148227888
ncbi acc num :
NP_001081637.1
ncbi gb acc num :
NM_001088168.1
uniprot acc num :
P28026
ncbi mol weight :
39.7kD
ncbi pathways :
Hedgehog Signaling Pathway (84658); Hedgehog Signaling Pathway (474); Melanogenesis Pathway (119297); Melanogenesis Pathway (504); Wnt Signaling Pathway (1085242); Wnt Signaling Pathway (1108216); Wnt Signaling Pathway (84656); Wnt Signaling Pathway (471)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
1100
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!