Recombinant Macaca mulatta (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4) | MyBioSource MBS1206454 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)

catalog :

MBS1206454

quantity :

1 mg (E-Coli)

price :

1285 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1206454

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)

products short name :

(Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)

products name syn :

Recombinant (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4); Serine/threonine-protein kinase 4 EC= 2.7.11.1 Cleaved into the following 2 chains: 1. Serine/threonine-protein kinase 4 37kDa subunit; 2. MST1/N 3. Serine/threonine-protein kinase 4 1

other names :

serine/threonine-protein kinase 4; Serine/threonine-protein kinase 4; serine/threonine-protein kinase 4

products gene name syn :

STK4

other gene names :

STK4; STK4; MST1/N; MST1/C

uniprot entry name :

STK4_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

327-487

sequence length :

487

sequence :

SGTMVRAVGDEMGTVRVASTMTDGASTMIEHDDTLPSQL
GTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEK
ENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVED
LQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKR
RQQNF

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

ncbi gi num :

274320186

ncbi acc num :

NP_001162148.1

ncbi gb acc num :

NM_001168677.1

uniprot acc num :

A4K2T0

ncbi mol weight :

55,605 Da

ncbi pathways :

MAPK Signaling Pathway (86718); MAPK Signaling Pathway (456); Non-small Cell Lung Cancer Pathway (86785); Non-small Cell Lung Cancer Pathway (531); Pathways In Cancer (86771)

uniprot summary :

Function: Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. STK3/MST2 and STK4/MST1 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation. Phosphorylates 'Ser-14' of histone H2B (H2BS14ph) during apoptosis. Phosphorylates FOXO3 upon oxidative stress, which results in its nuclear translocation and cell death initiation. Phosphorylates MOBKL1A, MOBKL1B and RASSF2. Phosphorylates TNNI3 (cardiac Tn-I) and alters its binding affinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T). Phosphorylates FOXO1 on 'Ser-212' and regulates its activation and stimulates transcription of PMAIP1 in a FOXO1-dependent manner. Phosphorylates SIRT1 and inhibits SIRT1-mediated p53/TP53 deacetylation, thereby promoting p53/TP53 dependent transcription and apoptosis upon DNA damage. Acts as an inhibitor of PKB/AKT1. Phosphorylates AR on 'Ser-650' and suppresses its activity by intersecting with PKB/AKT1 signaling and antagonizing formation of AR-chromatin complexes . By similarity. Catalytic activity: ATP + a protein = ADP + a phosphoprotein. Cofactor: Magnesium . By similarity. Enzyme regulation: Inhibited by the C-terminal non-catalytic region. Activated by caspase-cleavage. Full activation also requires homodimerization and autophosphorylation of Thr-183. Activated by RASSF1 which acts by preventing its dephosphorylation . By similarity. Subunit structure: Homodimer; mediated via the coiled-coil region. Interacts with NORE1, which inhibits autoactivation. Interacts with and stabilizes SAV1. Interacts with RASSF1. Interacts with FOXO3. Interacts with RASSF2 (via SARAH domain). Interacts with AR, PKB/AKT1, TNNI3 and SIRT1 . By similarity. Subcellular location: Cytoplasm . By similarity. Nucleus . By similarity. Note: The caspase-cleaved form cycles between the nucleus and cytoplasm . By similarity. Post-translational modification: Autophosphorylated on serine and threonine residues. Phosphorylation at Thr-120 and Thr-387 by PKB/AKT1, leads to inhibition of its: kinase activity, nuclear translocation and autophosphorylation at Thr-183. It also diminishes its cleavage by caspases and its ability to phosphorylate FOXO3 . By similarity.Proteolytically cleaved by caspase-3 during apoptosis at Asp-326 and Asp-349 resulting in a 37 kDa or a 39 kDa subunit respectively. The 39 kDa subunit is further cleaved into the 37 kDa form. Proteolytic cleavage results in kinase activation and nuclear translocation of the truncated form (MST1/N). It is less likely that cleavage at Asp-349 is a prerequisite for activation as this site is not conserved in the murine ortholog . By similarity. Sequence similarities: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.Contains 1 protein kinase domain.Contains 1 SARAH domain.

size1 :

1 mg (E-Coli)

price1 :

1285 USD

size2 :

1 mg (Yeast)

price2 :

1745

more info or order :

MyBioSource product webpage