product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)
catalog :
MBS1206454
quantity :
1 mg (E-Coli)
price :
1285 USD
more info or order :
product information
catalog number :
MBS1206454
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)
products short name :
(Rhesus macaque) Serine/threonine-protein kinase 4 (STK4)
products name syn :
Recombinant (Rhesus macaque) Serine/threonine-protein kinase 4 (STK4); Serine/threonine-protein kinase 4 EC= 2.7.11.1 Cleaved into the following 2 chains: 1. Serine/threonine-protein kinase 4 37kDa subunit; 2. MST1/N 3. Serine/threonine-protein kinase 4 1
other names :
serine/threonine-protein kinase 4; Serine/threonine-protein kinase 4; serine/threonine-protein kinase 4
products gene name syn :
STK4
other gene names :
STK4; STK4; MST1/N; MST1/C
uniprot entry name :
STK4_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
327-487
sequence length :
487
sequence :
SGTMVRAVGDEMGTVRVASTMTDGASTMIEHDDTLPSQL
GTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEK
ENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVED
LQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKR
RQQNF
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
274320186
ncbi acc num :
NP_001162148.1
ncbi gb acc num :
NM_001168677.1
uniprot acc num :
A4K2T0
ncbi mol weight :
55,605 Da
ncbi pathways :
MAPK Signaling Pathway (86718); MAPK Signaling Pathway (456); Non-small Cell Lung Cancer Pathway (86785); Non-small Cell Lung Cancer Pathway (531); Pathways In Cancer (86771)
uniprot summary :
Function: Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. STK3/MST2 and STK4/MST1 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation. Phosphorylates 'Ser-14' of histone H2B (H2BS14ph) during apoptosis. Phosphorylates FOXO3 upon oxidative stress, which results in its nuclear translocation and cell death initiation. Phosphorylates MOBKL1A, MOBKL1B and RASSF2. Phosphorylates TNNI3 (cardiac Tn-I) and alters its binding affinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T). Phosphorylates FOXO1 on 'Ser-212' and regulates its activation and stimulates transcription of PMAIP1 in a FOXO1-dependent manner. Phosphorylates SIRT1 and inhibits SIRT1-mediated p53/TP53 deacetylation, thereby promoting p53/TP53 dependent transcription and apoptosis upon DNA damage. Acts as an inhibitor of PKB/AKT1. Phosphorylates AR on 'Ser-650' and suppresses its activity by intersecting with PKB/AKT1 signaling and antagonizing formation of AR-chromatin complexes . By similarity. Catalytic activity: ATP + a protein = ADP + a phosphoprotein. Cofactor: Magnesium . By similarity. Enzyme regulation: Inhibited by the C-terminal non-catalytic region. Activated by caspase-cleavage. Full activation also requires homodimerization and autophosphorylation of Thr-183. Activated by RASSF1 which acts by preventing its dephosphorylation . By similarity. Subunit structure: Homodimer; mediated via the coiled-coil region. Interacts with NORE1, which inhibits autoactivation. Interacts with and stabilizes SAV1. Interacts with RASSF1. Interacts with FOXO3. Interacts with RASSF2 (via SARAH domain). Interacts with AR, PKB/AKT1, TNNI3 and SIRT1 . By similarity. Subcellular location: Cytoplasm . By similarity. Nucleus . By similarity. Note: The caspase-cleaved form cycles between the nucleus and cytoplasm . By similarity. Post-translational modification: Autophosphorylated on serine and threonine residues. Phosphorylation at Thr-120 and Thr-387 by PKB/AKT1, leads to inhibition of its: kinase activity, nuclear translocation and autophosphorylation at Thr-183. It also diminishes its cleavage by caspases and its ability to phosphorylate FOXO3 . By similarity.Proteolytically cleaved by caspase-3 during apoptosis at Asp-326 and Asp-349 resulting in a 37 kDa or a 39 kDa subunit respectively. The 39 kDa subunit is further cleaved into the 37 kDa form. Proteolytic cleavage results in kinase activation and nuclear translocation of the truncated form (MST1/N). It is less likely that cleavage at Asp-349 is a prerequisite for activation as this site is not conserved in the murine ortholog . By similarity. Sequence similarities: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.Contains 1 protein kinase domain.Contains 1 SARAH domain.
size1 :
1 mg (E-Coli)
price1 :
1285 USD
size2 :
1 mg (Yeast)
price2 :
1745
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!