product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Keratin, type I cuticular Ha8
catalog :
MBS1204354
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1204354
products type :
Recombinant Protein
products full name :
Recombinant Human Keratin, type I cuticular Ha8
products short name :
Keratin, type I cuticular Ha8
products name syn :
Hair keratin, type I Ha8; Keratin-38; K38
other names :
keratin, type I cuticular Ha8; Keratin, type I cuticular Ha8; keratin, type I cuticular Ha8; keratin 38, type I; Hair keratin, type I Ha8; Keratin-38; K38
products gene name :
KRT38
other gene names :
KRT38; KRT38; HA8; hHa8; KRTHA8; HHA8; HKA8; KRTHA8; K38
uniprot entry name :
KRT38_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-456
sequence length :
456
sequence :
TSSYSSSSCPLGCTMAPGARNVSVSPIDIGCQPGAEANI
APMCLLANVAHANRVRVGSTPLGRPSLCLPPTCHTACPL
PGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANY
LEKVRQLEQENAELEATLLERSKCHESTVCPDYQSYFHT
IEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESE
RSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQ
LSLKSNHEQEVKILRSQLGEK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products references :
Characterization of a 190-kilobase pair domain of human type I hair keratin genes.Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J.J. Biol. Chem. 273:26683-26691(1998) Schweizer J.DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)
ncbi gi num :
15431318
ncbi acc num :
NP_006762.3
ncbi gb acc num :
NM_006771.3
uniprot acc num :
O76015
ncbi mol weight :
66.3kD
ncbi summary :
The protein encoded by this gene is a member of the keratin gene family. As a type I hair keratin, it is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. [provided by RefSeq, Jul 2008]
uniprot summary :
KRT38: Belongs to the intermediate filament family. Protein type: Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 17q21.2. Cellular Component: intermediate filament. Molecular Function: protein binding; structural molecule activity
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1235
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!