Recombinant Human papillomavirus type 16 Protein E6 | MyBioSource MBS1200699 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human papillomavirus type 16 Protein E6

catalog :

MBS1200699

quantity :

0.05 mg (Yeast)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1200699

products type :

Recombinant Protein

products full name :

Recombinant Human papillomavirus type 16 Protein E6

products short name :

papillomavirus type 16 Protein E6

other names :

transforming protein; Protein E6; transforming protein

products gene name :

other gene names :

E6; E6

uniprot entry name :

VE6_HPV16

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-158, Full length

sequence length :

158

sequence :

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVY
CKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYS
KISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPL
CPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRET
QL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Epigenetics and Nuclear Signaling

products description :

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting th to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6P targets several other substrates to degradation via the proteasome including host NFX1-91, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including Bak, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.

products references :

Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985) Cloning and sequencing of non-European human papillomavirus (HPV)variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Expression of the human papillomavirus type 16 genome in SK-v cells, a line derived from a vulvar intraepithelial neoplasia.Schneider-Maunoury S., Pehau-Arnaudet G., Breitburd F., Orth G.J. Gen. Virol. 71:809-817(1990) Telomerase activation by the E6 gene product of human papillomavirus type 16.Klingelhutz A.J., Foster S.A., McDougall J.K.Nature 380:79-82(1996) Human papillomavirus 16 E6 oncoprotein binds to interferon regulatory factor-3 and inhibits its transcriptional activity.Ronco L.V., Karpova A.Y., Vidal M., Howley P.M.Genes Dev. 12:2061-2072(1998) The human papilloma virus (HPV)-18 E6 oncoprotein physically associates with Tyk2 and impairs Jak-STAT activation by interferon-alpha.Li S., Labrecque S., Gauzzi M.C., Cuddihy A.R., Wong A.H., Pellegrini S., Matlashewski G.J., Koromilas A.E.Oncogene 18:5727-5737(1999) Interaction of oncogenic papillomavirus E6 proteins with fibulin-1.Du M., Fan X., Hong E., Chen J.J.Biochem. Biophys. Res. Commun. 296:962-969(2002) Identification of a novel telomerase repressor that interacts with the human papillomavirus type-16 E6/E6-AP complex.Gewin L., Myers H., Kiyono T., Galloway D.A.Genes Dev. 18:2269-2282(2004) Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation.Thomas M., Laura R., Hepner K., Guccione E., Sawyers C., Lasky L., Banks L.Oncogene 21:5088-5096(2002) Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31.Lee C., Laimins L.A.J. Virol. 78:12366-12377(2004) HPV E6 specifically targets different cellular pools of its PDZ domain-containing tumour suppressor substrates for proteasome-mediated degradation.Massimi P., Gammoh N., Thomas M., Banks L.Oncogene 23:8033-8039(2004) Cellular and molecular biological aspects of cervical intraepithelial neoplasia.Kisseljov F., Sakharova O., Kondratjeva T.Int. Rev. Cytol. 271:35-95(2008)

ncbi gi num :

9627104

ncbi acc num :

NP_041325.1

ncbi gb acc num :

NC_001526.2

uniprot acc num :

P03126

ncbi mol weight :

23.3kD

ncbi pathways :

Regulation Of Telomerase Pathway (137987)

size1 :

0.05 mg (Yeast)

price1 :

190 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage